Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/CC2985(antitoxin)
Location 903527..904059 Replicon plasmid unnamed1
Accession NZ_CP120639
Organism Rhizobium sp. 32-5/1

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag P6U16_RS26025 Protein ID WP_277704283.1
Coordinates 903766..904059 (+) Length 98 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A657LKW1
Locus tag P6U16_RS26020 Protein ID WP_071835911.1
Coordinates 903527..903769 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6U16_RS26005 (P6U16_26005) 899846..900433 - 588 WP_277704833.1 TetR/AcrR family transcriptional regulator -
P6U16_RS26010 (P6U16_26010) 900573..901292 + 720 WP_277704281.1 SDR family oxidoreductase -
P6U16_RS26015 (P6U16_26015) 902076..903101 + 1026 WP_277704282.1 hypothetical protein -
P6U16_RS26020 (P6U16_26020) 903527..903769 + 243 WP_071835911.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
P6U16_RS26025 (P6U16_26025) 903766..904059 + 294 WP_277704283.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P6U16_RS26030 (P6U16_26030) 904159..905852 - 1694 Protein_931 hypothetical protein -
P6U16_RS26035 (P6U16_26035) 906058..906366 + 309 WP_131640949.1 type II toxin-antitoxin system RelB/DinJ family antitoxin -
P6U16_RS26040 (P6U16_26040) 906363..906656 + 294 Protein_933 type II toxin-antitoxin system RelE/ParE family toxin -
P6U16_RS26045 (P6U16_26045) 906788..907195 - 408 WP_277704284.1 GFA family protein -
P6U16_RS26050 (P6U16_26050) 907363..907608 + 246 Protein_935 transposase -
P6U16_RS26055 (P6U16_26055) 907838..908389 - 552 WP_277704285.1 YidB family protein -
P6U16_RS26060 (P6U16_26060) 908418..908912 - 495 WP_277704286.1 DUF892 family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..1086621 1086621


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-92)

Antitoxin

Antitoxin ParD

(1-79)


Sequences

Toxin        


Download         Length: 98 a.a.        Molecular weight: 11308.96 Da        Isoelectric Point: 5.9829

>T275322 WP_277704283.1 NZ_CP120639:903766-904059 [Rhizobium sp. 32-5/1]
MSFKLSVEAEEDIIAIAEQGARMFGVNQAKRYHDELFALLDLIAANPRIARERNEIEPPVRIHPFKAHLIVYRVEDDERI
FVVRIRHGHEDWASISM

Download         Length: 294 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8912.04 Da        Isoelectric Point: 8.5615

>AT275322 WP_071835911.1 NZ_CP120639:903527-903769 [Rhizobium sp. 32-5/1]
MATMNVSLPDPMKDWVEAQARTGRYSNASDYVRDLIRRDQTRNDKIAAMQSFVEAGLQSGVGIRSKDELFAEAMARASKS

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A657LKW1

References