Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/CC2985(antitoxin) |
| Location | 903527..904059 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP120639 | ||
| Organism | Rhizobium sp. 32-5/1 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | - |
| Locus tag | P6U16_RS26025 | Protein ID | WP_277704283.1 |
| Coordinates | 903766..904059 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A657LKW1 |
| Locus tag | P6U16_RS26020 | Protein ID | WP_071835911.1 |
| Coordinates | 903527..903769 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6U16_RS26005 (P6U16_26005) | 899846..900433 | - | 588 | WP_277704833.1 | TetR/AcrR family transcriptional regulator | - |
| P6U16_RS26010 (P6U16_26010) | 900573..901292 | + | 720 | WP_277704281.1 | SDR family oxidoreductase | - |
| P6U16_RS26015 (P6U16_26015) | 902076..903101 | + | 1026 | WP_277704282.1 | hypothetical protein | - |
| P6U16_RS26020 (P6U16_26020) | 903527..903769 | + | 243 | WP_071835911.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| P6U16_RS26025 (P6U16_26025) | 903766..904059 | + | 294 | WP_277704283.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P6U16_RS26030 (P6U16_26030) | 904159..905852 | - | 1694 | Protein_931 | hypothetical protein | - |
| P6U16_RS26035 (P6U16_26035) | 906058..906366 | + | 309 | WP_131640949.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| P6U16_RS26040 (P6U16_26040) | 906363..906656 | + | 294 | Protein_933 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| P6U16_RS26045 (P6U16_26045) | 906788..907195 | - | 408 | WP_277704284.1 | GFA family protein | - |
| P6U16_RS26050 (P6U16_26050) | 907363..907608 | + | 246 | Protein_935 | transposase | - |
| P6U16_RS26055 (P6U16_26055) | 907838..908389 | - | 552 | WP_277704285.1 | YidB family protein | - |
| P6U16_RS26060 (P6U16_26060) | 908418..908912 | - | 495 | WP_277704286.1 | DUF892 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..1086621 | 1086621 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11308.96 Da Isoelectric Point: 5.9829
>T275322 WP_277704283.1 NZ_CP120639:903766-904059 [Rhizobium sp. 32-5/1]
MSFKLSVEAEEDIIAIAEQGARMFGVNQAKRYHDELFALLDLIAANPRIARERNEIEPPVRIHPFKAHLIVYRVEDDERI
FVVRIRHGHEDWASISM
MSFKLSVEAEEDIIAIAEQGARMFGVNQAKRYHDELFALLDLIAANPRIARERNEIEPPVRIHPFKAHLIVYRVEDDERI
FVVRIRHGHEDWASISM
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|