Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-Phd
Location 754036..754721 Replicon plasmid unnamed1
Accession NZ_CP120639
Organism Rhizobium sp. 32-5/1

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag P6U16_RS25235 Protein ID WP_277704171.1
Coordinates 754036..754458 (-) Length 141 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag P6U16_RS25240 Protein ID WP_277704172.1
Coordinates 754455..754721 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6U16_RS25210 (P6U16_25210) 749372..750336 - 965 Protein_767 plasmid partitioning protein RepB -
P6U16_RS25215 (P6U16_25215) 750333..751542 - 1210 Protein_768 plasmid partitioning protein RepA -
P6U16_RS25220 (P6U16_25220) 752473..752643 - 171 WP_277704168.1 hypothetical protein -
P6U16_RS25225 (P6U16_25225) 752647..752808 - 162 WP_277704169.1 hypothetical protein -
P6U16_RS25230 (P6U16_25230) 753384..753998 - 615 WP_277704170.1 hypothetical protein -
P6U16_RS25235 (P6U16_25235) 754036..754458 - 423 WP_277704171.1 type II toxin-antitoxin system VapC family toxin Toxin
P6U16_RS25240 (P6U16_25240) 754455..754721 - 267 WP_277704172.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
P6U16_RS25245 (P6U16_25245) 754835..755050 - 216 Protein_774 exonuclease domain-containing protein -
P6U16_RS25250 (P6U16_25250) 755149..756258 - 1110 WP_277704173.1 hypothetical protein -
P6U16_RS25255 (P6U16_25255) 756201..756779 - 579 WP_277704174.1 hypothetical protein -
P6U16_RS25260 (P6U16_25260) 757437..758576 - 1140 Protein_777 site-specific integrase -
P6U16_RS25265 (P6U16_25265) 758573..758821 - 249 WP_277704175.1 prevent-host-death family protein -
P6U16_RS25270 (P6U16_25270) 758834..759211 - 378 WP_277704176.1 type II toxin-antitoxin system VapC family toxin -
P6U16_RS25275 (P6U16_25275) 759208..759501 - 294 WP_277704177.1 type II toxin-antitoxin system prevent-host-death family antitoxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..1086621 1086621


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-125)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(10-71)


Sequences

Toxin        


Download         Length: 141 a.a.        Molecular weight: 15701.26 Da        Isoelectric Point: 5.7643

>T275321 WP_277704171.1 NZ_CP120639:c754458-754036 [Rhizobium sp. 32-5/1]
MRLLLDTNVLSEVTKPRPVESVLKWLHCLDEDRTFISIISIAEIRRGVALMDAGRKRDALDEWLMYDLPQRFENRIIRVE
APVALAWGDLMALAKRSGRGLASMDGLIAATAVAHQLTLATRNTKDFAGFGIDIIDPWVD

Download         Length: 423 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9757.05 Da        Isoelectric Point: 6.4683

>AT275321 WP_277704172.1 NZ_CP120639:c754721-754455 [Rhizobium sp. 32-5/1]
MQASTHEDMSWTVAGAKAKLSEVMERAQVSPQTITRNGKPSVVVVSAEEWQKKIARRGSLAEFLLASPLRGADLDIERQH
DEPRDLSL

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References