Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC(toxin) |
| Location | 251846..252486 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP120639 | ||
| Organism | Rhizobium sp. 32-5/1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P6U16_RS22725 | Protein ID | WP_277704580.1 |
| Coordinates | 251846..252232 (-) | Length | 129 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | P6U16_RS22730 | Protein ID | WP_277704581.1 |
| Coordinates | 252232..252486 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6U16_RS22690 (P6U16_22690) | 247267..247590 | - | 324 | Protein_263 | transposase | - |
| P6U16_RS22695 (P6U16_22695) | 247675..248262 | - | 588 | WP_277704578.1 | hypothetical protein | - |
| P6U16_RS22700 (P6U16_22700) | 248168..248728 | - | 561 | WP_277704579.1 | hypothetical protein | - |
| P6U16_RS22705 (P6U16_22705) | 248890..249361 | - | 472 | Protein_266 | DDE-type integrase/transposase/recombinase | - |
| P6U16_RS22710 (P6U16_22710) | 249366..249556 | - | 191 | Protein_267 | ABC transporter permease | - |
| P6U16_RS22715 (P6U16_22715) | 249562..249865 | - | 304 | Protein_268 | FtsX-like permease family protein | - |
| P6U16_RS22720 (P6U16_22720) | 249853..251126 | - | 1274 | Protein_269 | recombinase family protein | - |
| P6U16_RS22725 (P6U16_22725) | 251846..252232 | - | 387 | WP_277704580.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P6U16_RS22730 (P6U16_22730) | 252232..252486 | - | 255 | WP_277704581.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P6U16_RS22735 (P6U16_22735) | 252750..252863 | - | 114 | Protein_272 | IS5/IS1182 family transposase | - |
| P6U16_RS22740 (P6U16_22740) | 252905..253330 | - | 426 | Protein_273 | DDE-type integrase/transposase/recombinase | - |
| P6U16_RS22745 (P6U16_22745) | 253952..255379 | + | 1428 | WP_277704582.1 | ISNCY family transposase | - |
| P6U16_RS22750 (P6U16_22750) | 255675..257048 | + | 1374 | WP_277704583.1 | ISNCY family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..1086621 | 1086621 | |
| - | inside | IScluster/Tn | - | - | 246329..257048 | 10719 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14056.88 Da Isoelectric Point: 6.2279
>T275320 WP_277704580.1 NZ_CP120639:c252232-251846 [Rhizobium sp. 32-5/1]
MVIDTSAIVAIFFNEPDAANYRERIANDPIRFISAATLVEASMVIEGRFGEAGGAELDLWVHKANVEVVAVTAEHADQAR
RAWRRYGKGRHPASLNYGDCFSYALATLAGEPLLFKGNDFKQTNIRAA
MVIDTSAIVAIFFNEPDAANYRERIANDPIRFISAATLVEASMVIEGRFGEAGGAELDLWVHKANVEVVAVTAEHADQAR
RAWRRYGKGRHPASLNYGDCFSYALATLAGEPLLFKGNDFKQTNIRAA
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|