Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 147909..148540 Replicon plasmid unnamed1
Accession NZ_CP120639
Organism Rhizobium sp. 32-5/1

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag P6U16_RS22160 Protein ID WP_277704512.1
Coordinates 148139..148540 (+) Length 134 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag P6U16_RS22155 Protein ID WP_277704511.1
Coordinates 147909..148139 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6U16_RS22110 (P6U16_22110) 143291..143533 - 243 WP_277704881.1 hypothetical protein -
P6U16_RS22115 (P6U16_22115) 143616..143870 - 255 WP_277704506.1 hypothetical protein -
P6U16_RS22120 (P6U16_22120) 144197..144646 + 450 WP_277704507.1 hypothetical protein -
P6U16_RS22125 (P6U16_22125) 144847..145278 + 432 WP_277704508.1 OmpA family protein -
P6U16_RS22130 (P6U16_22130) 145280..145510 + 231 WP_277704509.1 hypothetical protein -
P6U16_RS22135 (P6U16_22135) 145655..145819 + 165 WP_277704510.1 hypothetical protein -
P6U16_RS22140 (P6U16_22140) 145923..146630 - 708 WP_277704859.1 helix-turn-helix transcriptional regulator -
P6U16_RS22145 (P6U16_22145) 146574..146726 + 153 WP_277704882.1 hypothetical protein -
P6U16_RS22150 (P6U16_22150) 147120..147665 - 546 Protein_155 IS110 family transposase -
P6U16_RS22155 (P6U16_22155) 147909..148139 + 231 WP_277704511.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
P6U16_RS22160 (P6U16_22160) 148139..148540 + 402 WP_277704512.1 tRNA(fMet)-specific endonuclease VapC Toxin
P6U16_RS22165 (P6U16_22165) 148664..148991 + 328 Protein_158 helix-turn-helix domain-containing protein -
P6U16_RS22170 (P6U16_22170) 149155..149931 - 777 WP_277704513.1 IS21-like element helper ATPase IstB -
P6U16_RS22175 (P6U16_22175) 149943..151494 - 1552 Protein_160 IS21 family transposase -
P6U16_RS22180 (P6U16_22180) 151765..153064 + 1300 Protein_161 IS701 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..1086621 1086621


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(7-35)


Sequences

Toxin        


Download         Length: 134 a.a.        Molecular weight: 15007.20 Da        Isoelectric Point: 7.8526

>T275319 WP_277704512.1 NZ_CP120639:148139-148540 [Rhizobium sp. 32-5/1]
MLKYMLDTNICIFTIKNRPQQLREAFNRFRDQLCISSVSLMELIYGAEKSASPEKNLPVVEGFAARLEVLPYDEPAASHT
GQLRAELARSGTPIGPYDQLIAGHARSRGLIMVTNNRREFDRVPGLRVEDWTG

Download         Length: 402 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8378.34 Da        Isoelectric Point: 4.5045

>AT275319 WP_277704511.1 NZ_CP120639:147909-148139 [Rhizobium sp. 32-5/1]
VEQGAVFQSNRSQAIRLPKAVALPDDVKRVDIVVVGRTRIIAPAGEVWDSWFEGAAATSDFMSERDQTASQEREAF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References