Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 147909..148540 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP120639 | ||
| Organism | Rhizobium sp. 32-5/1 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P6U16_RS22160 | Protein ID | WP_277704512.1 |
| Coordinates | 148139..148540 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | P6U16_RS22155 | Protein ID | WP_277704511.1 |
| Coordinates | 147909..148139 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6U16_RS22110 (P6U16_22110) | 143291..143533 | - | 243 | WP_277704881.1 | hypothetical protein | - |
| P6U16_RS22115 (P6U16_22115) | 143616..143870 | - | 255 | WP_277704506.1 | hypothetical protein | - |
| P6U16_RS22120 (P6U16_22120) | 144197..144646 | + | 450 | WP_277704507.1 | hypothetical protein | - |
| P6U16_RS22125 (P6U16_22125) | 144847..145278 | + | 432 | WP_277704508.1 | OmpA family protein | - |
| P6U16_RS22130 (P6U16_22130) | 145280..145510 | + | 231 | WP_277704509.1 | hypothetical protein | - |
| P6U16_RS22135 (P6U16_22135) | 145655..145819 | + | 165 | WP_277704510.1 | hypothetical protein | - |
| P6U16_RS22140 (P6U16_22140) | 145923..146630 | - | 708 | WP_277704859.1 | helix-turn-helix transcriptional regulator | - |
| P6U16_RS22145 (P6U16_22145) | 146574..146726 | + | 153 | WP_277704882.1 | hypothetical protein | - |
| P6U16_RS22150 (P6U16_22150) | 147120..147665 | - | 546 | Protein_155 | IS110 family transposase | - |
| P6U16_RS22155 (P6U16_22155) | 147909..148139 | + | 231 | WP_277704511.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| P6U16_RS22160 (P6U16_22160) | 148139..148540 | + | 402 | WP_277704512.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| P6U16_RS22165 (P6U16_22165) | 148664..148991 | + | 328 | Protein_158 | helix-turn-helix domain-containing protein | - |
| P6U16_RS22170 (P6U16_22170) | 149155..149931 | - | 777 | WP_277704513.1 | IS21-like element helper ATPase IstB | - |
| P6U16_RS22175 (P6U16_22175) | 149943..151494 | - | 1552 | Protein_160 | IS21 family transposase | - |
| P6U16_RS22180 (P6U16_22180) | 151765..153064 | + | 1300 | Protein_161 | IS701 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..1086621 | 1086621 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 15007.20 Da Isoelectric Point: 7.8526
>T275319 WP_277704512.1 NZ_CP120639:148139-148540 [Rhizobium sp. 32-5/1]
MLKYMLDTNICIFTIKNRPQQLREAFNRFRDQLCISSVSLMELIYGAEKSASPEKNLPVVEGFAARLEVLPYDEPAASHT
GQLRAELARSGTPIGPYDQLIAGHARSRGLIMVTNNRREFDRVPGLRVEDWTG
MLKYMLDTNICIFTIKNRPQQLREAFNRFRDQLCISSVSLMELIYGAEKSASPEKNLPVVEGFAARLEVLPYDEPAASHT
GQLRAELARSGTPIGPYDQLIAGHARSRGLIMVTNNRREFDRVPGLRVEDWTG
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|