Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-MazE |
Location | 1016856..1017484 | Replicon | chromosome |
Accession | NZ_CP120638 | ||
Organism | Rhizobium sp. 32-5/1 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P6U16_RS05320 | Protein ID | WP_277702888.1 |
Coordinates | 1016856..1017257 (-) | Length | 134 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | P6U16_RS05325 | Protein ID | WP_277702889.1 |
Coordinates | 1017254..1017484 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P6U16_RS05310 (P6U16_05310) | 1013031..1014656 | - | 1626 | WP_277702886.1 | diguanylate cyclase | - |
P6U16_RS05315 (P6U16_05315) | 1014886..1016730 | + | 1845 | WP_277702887.1 | caspase family protein | - |
P6U16_RS05320 (P6U16_05320) | 1016856..1017257 | - | 402 | WP_277702888.1 | PIN domain-containing protein | Toxin |
P6U16_RS05325 (P6U16_05325) | 1017254..1017484 | - | 231 | WP_277702889.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
P6U16_RS05330 (P6U16_05330) | 1017550..1021009 | - | 3460 | Protein_1044 | chromosome segregation protein SMC | - |
P6U16_RS05335 (P6U16_05335) | 1021093..1021977 | - | 885 | WP_277704017.1 | DsbA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14770.11 Da Isoelectric Point: 6.8382
>T275317 WP_277702888.1 NZ_CP120638:c1017257-1016856 [Rhizobium sp. 32-5/1]
VKAFFDTNVLVYLVSDDPKKIPAAACLRQGGIVSVQVLNEFVHVVRRKLRHDWNTIELALKHFHIALDDIVPLTAQFHAA
ALPLARDHGLTIYDALIVAAAIEAGCDTLFSEDMQHGRAFGRVTIRNPFLETV
VKAFFDTNVLVYLVSDDPKKIPAAACLRQGGIVSVQVLNEFVHVVRRKLRHDWNTIELALKHFHIALDDIVPLTAQFHAA
ALPLARDHGLTIYDALIVAAAIEAGCDTLFSEDMQHGRAFGRVTIRNPFLETV
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|