Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 5063890..5064679 Replicon chromosome
Accession NZ_CP120633
Organism Escherichia coli strain USVAST219

Toxin (Protein)


Gene name yeeV Uniprot ID A7ZRI1
Locus tag P6O79_RS24735 Protein ID WP_000854738.1
Coordinates 5064302..5064679 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3F3P6A6
Locus tag P6O79_RS24730 Protein ID WP_021543706.1
Coordinates 5063890..5064255 (+) Length 122 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6O79_RS24695 (5059866) 5059866..5060621 + 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
P6O79_RS24700 (5060765) 5060765..5061583 + 819 WP_001620924.1 DUF932 domain-containing protein -
P6O79_RS24705 (5061583) 5061583..5061828 + 246 WP_001620925.1 hypothetical protein -
P6O79_RS24710 (5061922) 5061922..5062401 + 480 WP_021543703.1 antirestriction protein -
P6O79_RS24715 (5062417) 5062417..5062893 + 477 WP_021543704.1 RadC family protein -
P6O79_RS24720 (5062956) 5062956..5063177 + 222 WP_000692300.1 DUF987 domain-containing protein -
P6O79_RS24725 (5063196) 5063196..5063840 + 645 WP_021543705.1 hypothetical protein -
P6O79_RS24730 (5063890) 5063890..5064255 + 366 WP_021543706.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P6O79_RS24735 (5064302) 5064302..5064679 + 378 WP_000854738.1 TA system toxin CbtA family protein Toxin
P6O79_RS24740 (5064676) 5064676..5065179 + 504 WP_021531035.1 DUF5983 family protein -
P6O79_RS24745 (5065176) 5065176..5065373 + 198 WP_000839287.1 DUF957 domain-containing protein -
P6O79_RS24750 (5065470) 5065470..5066313 + 844 Protein_4835 DUF4942 domain-containing protein -
P6O79_RS24760 (5066916) 5066916..5067509 - 594 WP_001576618.1 hypothetical protein -
P6O79_RS24765 (5067511) 5067511..5068125 - 615 WP_001576620.1 hypothetical protein -
P6O79_RS24770 (5068127) 5068127..5068654 - 528 WP_001576621.1 Mor transcription activator family protein -
P6O79_RS24775 (5068895) 5068895..5069173 - 279 WP_001576623.1 hypothetical protein -
P6O79_RS24780 (5069170) 5069170..5069649 - 480 WP_001576624.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 5017698..5098374 80676


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14089.12 Da        Isoelectric Point: 8.2904

>T275311 WP_000854738.1 NZ_CP120633:5064302-5064679 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMVRDNYRTVNNITLGKHPGAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 122 a.a.        Molecular weight: 13293.89 Da        Isoelectric Point: 4.7511

>AT275311 WP_021543706.1 NZ_CP120633:5063890-5064255 [Escherichia coli]
VSDTLHETNYPDDNNDRGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSGELN
PRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTLAPATTS

Download         Length: 366 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A7ZRI1

Antitoxin

Source ID Structure
AlphaFold DB A0A3F3P6A6

References