Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 5063890..5064679 | Replicon | chromosome |
| Accession | NZ_CP120633 | ||
| Organism | Escherichia coli strain USVAST219 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZRI1 |
| Locus tag | P6O79_RS24735 | Protein ID | WP_000854738.1 |
| Coordinates | 5064302..5064679 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3F3P6A6 |
| Locus tag | P6O79_RS24730 | Protein ID | WP_021543706.1 |
| Coordinates | 5063890..5064255 (+) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6O79_RS24695 (5059866) | 5059866..5060621 | + | 756 | WP_000065240.1 | IS21-like element ISEc10 family helper ATPase IstB | - |
| P6O79_RS24700 (5060765) | 5060765..5061583 | + | 819 | WP_001620924.1 | DUF932 domain-containing protein | - |
| P6O79_RS24705 (5061583) | 5061583..5061828 | + | 246 | WP_001620925.1 | hypothetical protein | - |
| P6O79_RS24710 (5061922) | 5061922..5062401 | + | 480 | WP_021543703.1 | antirestriction protein | - |
| P6O79_RS24715 (5062417) | 5062417..5062893 | + | 477 | WP_021543704.1 | RadC family protein | - |
| P6O79_RS24720 (5062956) | 5062956..5063177 | + | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
| P6O79_RS24725 (5063196) | 5063196..5063840 | + | 645 | WP_021543705.1 | hypothetical protein | - |
| P6O79_RS24730 (5063890) | 5063890..5064255 | + | 366 | WP_021543706.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P6O79_RS24735 (5064302) | 5064302..5064679 | + | 378 | WP_000854738.1 | TA system toxin CbtA family protein | Toxin |
| P6O79_RS24740 (5064676) | 5064676..5065179 | + | 504 | WP_021531035.1 | DUF5983 family protein | - |
| P6O79_RS24745 (5065176) | 5065176..5065373 | + | 198 | WP_000839287.1 | DUF957 domain-containing protein | - |
| P6O79_RS24750 (5065470) | 5065470..5066313 | + | 844 | Protein_4835 | DUF4942 domain-containing protein | - |
| P6O79_RS24760 (5066916) | 5066916..5067509 | - | 594 | WP_001576618.1 | hypothetical protein | - |
| P6O79_RS24765 (5067511) | 5067511..5068125 | - | 615 | WP_001576620.1 | hypothetical protein | - |
| P6O79_RS24770 (5068127) | 5068127..5068654 | - | 528 | WP_001576621.1 | Mor transcription activator family protein | - |
| P6O79_RS24775 (5068895) | 5068895..5069173 | - | 279 | WP_001576623.1 | hypothetical protein | - |
| P6O79_RS24780 (5069170) | 5069170..5069649 | - | 480 | WP_001576624.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 5017698..5098374 | 80676 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14089.12 Da Isoelectric Point: 8.2904
>T275311 WP_000854738.1 NZ_CP120633:5064302-5064679 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMVRDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMVRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13293.89 Da Isoelectric Point: 4.7511
>AT275311 WP_021543706.1 NZ_CP120633:5063890-5064255 [Escherichia coli]
VSDTLHETNYPDDNNDRGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSGELN
PRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSGELN
PRHQHTVTLYAKGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A7ZRI1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3F3P6A6 |