Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4150675..4151195 Replicon chromosome
Accession NZ_CP120633
Organism Escherichia coli strain USVAST219

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag P6O79_RS20330 Protein ID WP_001160964.1
Coordinates 4150911..4151195 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag P6O79_RS20325 Protein ID WP_000125566.1
Coordinates 4150675..4150908 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6O79_RS20300 (4145748) 4145748..4146035 + 288 WP_000203744.1 ferredoxin-like protein FixX -
P6O79_RS20305 (4146094) 4146094..4147425 + 1332 WP_001183209.1 MFS transporter -
P6O79_RS20310 (4147533) 4147533..4148063 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
P6O79_RS20315 (4148056) 4148056..4149918 + 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
P6O79_RS20320 (4150110) 4150110..4150589 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
P6O79_RS20325 (4150675) 4150675..4150908 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
P6O79_RS20330 (4150911) 4150911..4151195 + 285 WP_001160964.1 CcdB family protein Toxin
P6O79_RS20335 (4151222) 4151222..4152070 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
P6O79_RS20340 (4152077) 4152077..4152454 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
P6O79_RS20345 (4152457) 4152457..4153278 - 822 WP_277715586.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
P6O79_RS20350 (4153275) 4153275..4154264 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
P6O79_RS20355 (4154264) 4154264..4155550 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T275307 WP_001160964.1 NZ_CP120633:4150911-4151195 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT275307 WP_000125566.1 NZ_CP120633:4150675-4150908 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References