Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3222182..3223017 Replicon chromosome
Accession NZ_CP120633
Organism Escherichia coli strain USVAST219

Toxin (Protein)


Gene name yeeV Uniprot ID A0A376WVB1
Locus tag P6O79_RS16025 Protein ID WP_001094448.1
Coordinates 3222640..3223017 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A3T7EC32
Locus tag P6O79_RS16020 Protein ID WP_024175935.1
Coordinates 3222182..3222550 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6O79_RS15985 (3217195) 3217195..3217428 + 234 WP_001117568.1 DUF905 family protein -
P6O79_RS15990 (3217628) 3217628..3219127 + 1500 WP_000174402.1 IS21-like element ISEc10 family transposase -
P6O79_RS15995 (3219124) 3219124..3219879 + 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
P6O79_RS16000 (3219932) 3219932..3220753 + 822 WP_277715578.1 DUF932 domain-containing protein -
P6O79_RS16005 (3220845) 3220845..3221330 + 486 WP_000214415.1 antirestriction protein -
P6O79_RS16010 (3221342) 3221342..3221818 + 477 WP_001618155.1 RadC family protein -
P6O79_RS16015 (3221887) 3221887..3222108 + 222 WP_000692346.1 DUF987 domain-containing protein -
P6O79_RS16020 (3222182) 3222182..3222550 + 369 WP_024175935.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P6O79_RS16025 (3222640) 3222640..3223017 + 378 WP_001094448.1 TA system toxin CbtA family protein Toxin
P6O79_RS16030 (3223014) 3223014..3223502 + 489 WP_000761714.1 DUF5983 family protein -
P6O79_RS16035 (3223514) 3223514..3223706 + 193 Protein_3151 hypothetical protein -
P6O79_RS16040 (3223791) 3223791..3224636 + 846 WP_001576423.1 DUF4942 domain-containing protein -
P6O79_RS16045 (3225229) 3225229..3225726 + 498 WP_000509815.1 hypothetical protein -
P6O79_RS16050 (3225904) 3225904..3226827 + 924 WP_000535950.1 carboxylate/amino acid/amine transporter -
P6O79_RS16055 (3226831) 3226831..3227649 - 819 WP_000779409.1 lipoprotein NlpA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14221.22 Da        Isoelectric Point: 8.2919

>T275302 WP_001094448.1 NZ_CP120633:3222640-3223017 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13598.40 Da        Isoelectric Point: 6.6255

>AT275302 WP_024175935.1 NZ_CP120633:3222182-3222550 [Escherichia coli]
VSDTLSGTTHPDDNDDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A376WVB1

Antitoxin

Source ID Structure
AlphaFold DB A0A3T7EC32

References