Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3222182..3223017 | Replicon | chromosome |
| Accession | NZ_CP120633 | ||
| Organism | Escherichia coli strain USVAST219 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A376WVB1 |
| Locus tag | P6O79_RS16025 | Protein ID | WP_001094448.1 |
| Coordinates | 3222640..3223017 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3T7EC32 |
| Locus tag | P6O79_RS16020 | Protein ID | WP_024175935.1 |
| Coordinates | 3222182..3222550 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6O79_RS15985 (3217195) | 3217195..3217428 | + | 234 | WP_001117568.1 | DUF905 family protein | - |
| P6O79_RS15990 (3217628) | 3217628..3219127 | + | 1500 | WP_000174402.1 | IS21-like element ISEc10 family transposase | - |
| P6O79_RS15995 (3219124) | 3219124..3219879 | + | 756 | WP_000065240.1 | IS21-like element ISEc10 family helper ATPase IstB | - |
| P6O79_RS16000 (3219932) | 3219932..3220753 | + | 822 | WP_277715578.1 | DUF932 domain-containing protein | - |
| P6O79_RS16005 (3220845) | 3220845..3221330 | + | 486 | WP_000214415.1 | antirestriction protein | - |
| P6O79_RS16010 (3221342) | 3221342..3221818 | + | 477 | WP_001618155.1 | RadC family protein | - |
| P6O79_RS16015 (3221887) | 3221887..3222108 | + | 222 | WP_000692346.1 | DUF987 domain-containing protein | - |
| P6O79_RS16020 (3222182) | 3222182..3222550 | + | 369 | WP_024175935.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P6O79_RS16025 (3222640) | 3222640..3223017 | + | 378 | WP_001094448.1 | TA system toxin CbtA family protein | Toxin |
| P6O79_RS16030 (3223014) | 3223014..3223502 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
| P6O79_RS16035 (3223514) | 3223514..3223706 | + | 193 | Protein_3151 | hypothetical protein | - |
| P6O79_RS16040 (3223791) | 3223791..3224636 | + | 846 | WP_001576423.1 | DUF4942 domain-containing protein | - |
| P6O79_RS16045 (3225229) | 3225229..3225726 | + | 498 | WP_000509815.1 | hypothetical protein | - |
| P6O79_RS16050 (3225904) | 3225904..3226827 | + | 924 | WP_000535950.1 | carboxylate/amino acid/amine transporter | - |
| P6O79_RS16055 (3226831) | 3226831..3227649 | - | 819 | WP_000779409.1 | lipoprotein NlpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14221.22 Da Isoelectric Point: 8.2919
>T275302 WP_001094448.1 NZ_CP120633:3222640-3223017 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13598.40 Da Isoelectric Point: 6.6255
>AT275302 WP_024175935.1 NZ_CP120633:3222182-3222550 [Escherichia coli]
VSDTLSGTTHPDDNDDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDRLWWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A376WVB1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3T7EC32 |