Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2384374..2385208 Replicon chromosome
Accession NZ_CP120633
Organism Escherichia coli strain USVAST219

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag P6O79_RS11995 Protein ID WP_000854690.1
Coordinates 2384831..2385208 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag P6O79_RS11990 Protein ID WP_001305076.1
Coordinates 2384374..2384742 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P6O79_RS11950 (2379456) 2379456..2380583 + 1128 Protein_2347 hypothetical protein -
P6O79_RS11955 (2380659) 2380659..2381114 + 456 WP_000581502.1 IrmA family protein -
P6O79_RS11960 (2381193) 2381193..2381426 + 234 WP_000902034.1 DUF905 family protein -
P6O79_RS11965 (2381527) 2381527..2382345 + 819 WP_001234628.1 DUF932 domain-containing protein -
P6O79_RS11970 (2382400) 2382400..2382885 + 486 WP_000849565.1 antirestriction protein -
P6O79_RS11975 (2382901) 2382901..2383377 + 477 WP_001186726.1 RadC family protein -
P6O79_RS11980 (2383440) 2383440..2383661 + 222 WP_000692329.1 DUF987 domain-containing protein -
P6O79_RS11985 (2383680) 2383680..2384324 + 645 WP_000094916.1 hypothetical protein -
P6O79_RS11990 (2384374) 2384374..2384742 + 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P6O79_RS11995 (2384831) 2384831..2385208 + 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
P6O79_RS12000 (2385205) 2385205..2385693 + 489 WP_000761699.1 DUF5983 family protein -
P6O79_RS12005 (2385710) 2385710..2385907 + 198 WP_000839293.1 DUF957 domain-containing protein -
P6O79_RS12010 (2385992) 2385992..2386837 + 846 WP_001529401.1 DUF4942 domain-containing protein -
P6O79_RS12015 (2386906) 2386906..2387301 + 396 WP_000208382.1 DUF6088 family protein -
P6O79_RS12020 (2387294) 2387294..2388227 + 934 Protein_2361 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
P6O79_RS12025 (2388644) 2388644..2388814 + 171 Protein_2362 IS110 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsF / kpsE / kpsD / kpsU / kpsC / kpsS / ugd / kpsT 2339920..2406417 66497
- flank IS/Tn - - 2388659..2388814 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T275298 WP_000854690.1 NZ_CP120633:2384831-2385208 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT275298 WP_001305076.1 NZ_CP120633:2384374-2384742 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References