Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 2239630..2240284 | Replicon | chromosome |
| Accession | NZ_CP120633 | ||
| Organism | Escherichia coli strain USVAST219 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | P6O79_RS11215 | Protein ID | WP_000244781.1 |
| Coordinates | 2239630..2240037 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | P6O79_RS11220 | Protein ID | WP_000354046.1 |
| Coordinates | 2240018..2240284 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P6O79_RS11195 (2235587) | 2235587..2237320 | - | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| P6O79_RS11200 (2237326) | 2237326..2238036 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| P6O79_RS11205 (2238061) | 2238061..2238957 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
| P6O79_RS11210 (2239069) | 2239069..2239590 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
| P6O79_RS11215 (2239630) | 2239630..2240037 | - | 408 | WP_000244781.1 | protein YgfX | Toxin |
| P6O79_RS11220 (2240018) | 2240018..2240284 | - | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| P6O79_RS11225 (2240527) | 2240527..2241507 | + | 981 | WP_000886079.1 | tRNA-modifying protein YgfZ | - |
| P6O79_RS11230 (2241584) | 2241584..2242243 | - | 660 | WP_000250274.1 | hemolysin III family protein | - |
| P6O79_RS11235 (2242407) | 2242407..2242718 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| P6O79_RS11240 (2242763) | 2242763..2244196 | + | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T275297 WP_000244781.1 NZ_CP120633:c2240037-2239630 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|