Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 5134731..5135259 | Replicon | chromosome |
| Accession | NZ_CP120626 | ||
| Organism | Pseudomonas sp. NyZ480 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | P3R38_RS23615 | Protein ID | WP_023382869.1 |
| Coordinates | 5134731..5135030 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2L1HF13 |
| Locus tag | P3R38_RS23620 | Protein ID | WP_023382870.1 |
| Coordinates | 5135020..5135259 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P3R38_RS23580 (P3R38_23580) | 5129861..5130550 | + | 690 | WP_023382809.1 | ABC transporter permease | - |
| P3R38_RS23585 (P3R38_23585) | 5130623..5131828 | + | 1206 | WP_277686659.1 | methyltransferase | - |
| P3R38_RS23590 (P3R38_23590) | 5132156..5132428 | - | 273 | WP_023382811.1 | DUF3077 domain-containing protein | - |
| P3R38_RS23595 (P3R38_23595) | 5132434..5132700 | - | 267 | WP_277686660.1 | hypothetical protein | - |
| P3R38_RS23600 (P3R38_23600) | 5133222..5133470 | + | 249 | WP_023382813.1 | hypothetical protein | - |
| P3R38_RS23615 (P3R38_23615) | 5134731..5135030 | - | 300 | WP_023382869.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| P3R38_RS23620 (P3R38_23620) | 5135020..5135259 | - | 240 | WP_023382870.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| P3R38_RS23625 (P3R38_23625) | 5135599..5137878 | - | 2280 | WP_104882327.1 | TonB-dependent siderophore receptor | - |
| P3R38_RS23630 (P3R38_23630) | 5138035..5138754 | + | 720 | WP_277686662.1 | response regulator transcription factor | - |
| P3R38_RS23635 (P3R38_23635) | 5138747..5140123 | + | 1377 | WP_023382873.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 5133753..5134193 | 440 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11496.39 Da Isoelectric Point: 10.2270
>T275285 WP_023382869.1 NZ_CP120626:c5135030-5134731 [Pseudomonas sp. NyZ480]
MTYSLEFDARALKEWQKLGDTVRQQLKKKLASVLLNPRVEANRLHSLPDCYKIKLRSSGYRLVYQVIEQEVVVFVVAVDK
REREQAYLKAAERVVGKTS
MTYSLEFDARALKEWQKLGDTVRQQLKKKLASVLLNPRVEANRLHSLPDCYKIKLRSSGYRLVYQVIEQEVVVFVVAVDK
REREQAYLKAAERVVGKTS
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|