Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1297759..1298675 | Replicon | chromosome |
Accession | NZ_CP120622 | ||
Organism | Bacillus subtilis strain DSM 1090 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | P5647_RS06810 | Protein ID | WP_003244695.1 |
Coordinates | 1297929..1298675 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | P5647_RS06805 | Protein ID | WP_003232646.1 |
Coordinates | 1297759..1297929 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5647_RS06770 (1294622) | 1294622..1294951 | + | 330 | WP_003232660.1 | XkdW family protein | - |
P5647_RS06775 (1294948) | 1294948..1295112 | + | 165 | WP_003232658.1 | XkdX family protein | - |
P5647_RS06780 (1295156) | 1295156..1295995 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
P5647_RS06785 (1296048) | 1296048..1296317 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
P5647_RS06790 (1296330) | 1296330..1296593 | + | 264 | WP_003232653.1 | phage holin | - |
P5647_RS06795 (1296606) | 1296606..1297499 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
P5647_RS06800 (1297536) | 1297536..1297673 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
P5647_RS06805 (1297759) | 1297759..1297929 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
P5647_RS06810 (1297929) | 1297929..1298675 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
P5647_RS06815 (1298785) | 1298785..1299786 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
P5647_RS06820 (1299799) | 1299799..1300416 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
P5647_RS06825 (1300692) | 1300692..1302008 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
P5647_RS06830 (1302397) | 1302397..1303347 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
P5647_RS06835 (1303448) | 1303448..1303594 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T275276 WP_003244695.1 NZ_CP120622:c1298675-1297929 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|