Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 488468..489104 | Replicon | chromosome |
Accession | NZ_CP120622 | ||
Organism | Bacillus subtilis strain DSM 1090 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | P5647_RS02490 | Protein ID | WP_003156187.1 |
Coordinates | 488754..489104 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | P5647_RS02485 | Protein ID | WP_003225183.1 |
Coordinates | 488468..488749 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5647_RS02465 (484827) | 484827..485426 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
P5647_RS02470 (485521) | 485521..485886 | + | 366 | WP_003234281.1 | holo-ACP synthase | - |
P5647_RS02475 (486052) | 486052..487068 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
P5647_RS02480 (487183) | 487183..488352 | + | 1170 | WP_003234284.1 | alanine racemase | - |
P5647_RS02485 (488468) | 488468..488749 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
P5647_RS02490 (488754) | 488754..489104 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P5647_RS02495 (489219) | 489219..490043 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
P5647_RS02500 (490048) | 490048..490413 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
P5647_RS02505 (490417) | 490417..490818 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
P5647_RS02510 (490830) | 490830..491837 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
P5647_RS02515 (491899) | 491899..492228 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
P5647_RS02520 (492225) | 492225..492707 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
P5647_RS02525 (492673) | 492673..493461 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
P5647_RS02530 (493461) | 493461..494060 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T275275 WP_003156187.1 NZ_CP120622:488754-489104 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|