Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 3314517..3315433 | Replicon | chromosome |
Accession | NZ_CP120621 | ||
Organism | Bacillus subtilis strain DSM 13019 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | P5657_RS17470 | Protein ID | WP_003244695.1 |
Coordinates | 3314517..3315263 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | P5657_RS17475 | Protein ID | WP_003232646.1 |
Coordinates | 3315263..3315433 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5657_RS17445 (P5657_17445) | 3309635..3309736 | - | 102 | Protein_3391 | hypothetical protein | - |
P5657_RS17450 (P5657_17450) | 3309845..3310795 | - | 951 | WP_277710026.1 | ring-cleaving dioxygenase | - |
P5657_RS17455 (P5657_17455) | 3311184..3312500 | + | 1317 | WP_021479457.1 | serine/threonine exchanger | - |
P5657_RS17460 (P5657_17460) | 3312776..3313393 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
P5657_RS17465 (P5657_17465) | 3313406..3314407 | + | 1002 | WP_021479458.1 | inorganic phosphate transporter | - |
P5657_RS17470 (P5657_17470) | 3314517..3315263 | + | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
P5657_RS17475 (P5657_17475) | 3315263..3315433 | + | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
P5657_RS17480 (P5657_17480) | 3315519..3315656 | + | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
P5657_RS17485 (P5657_17485) | 3315693..3316586 | - | 894 | WP_021479459.1 | N-acetylmuramoyl-L-alanine amidase | - |
P5657_RS17490 (P5657_17490) | 3316599..3316862 | - | 264 | WP_014479566.1 | phage holin | - |
P5657_RS17495 (P5657_17495) | 3316875..3317144 | - | 270 | WP_014479565.1 | hemolysin XhlA family protein | - |
P5657_RS17500 (P5657_17500) | 3317197..3318036 | - | 840 | WP_163182364.1 | phage-like element PBSX protein XepA | - |
P5657_RS17505 (P5657_17505) | 3318083..3318247 | - | 165 | WP_014479563.1 | XkdX family protein | - |
P5657_RS17510 (P5657_17510) | 3318244..3318573 | - | 330 | WP_014479562.1 | XkdW family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T275274 WP_003244695.1 NZ_CP120621:3314517-3315263 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|