Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 93994..94630 | Replicon | chromosome |
Accession | NZ_CP120621 | ||
Organism | Bacillus subtilis strain DSM 13019 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | P5657_RS00560 | Protein ID | WP_003156187.1 |
Coordinates | 93994..94344 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | P5657_RS00565 | Protein ID | WP_003225183.1 |
Coordinates | 94349..94630 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5657_RS00520 (P5657_00520) | 89030..89629 | - | 600 | WP_021481701.1 | phosphoserine phosphatase RsbX | - |
P5657_RS00525 (P5657_00525) | 89629..90417 | - | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
P5657_RS00530 (P5657_00530) | 90383..90865 | - | 483 | WP_021481702.1 | anti-sigma B factor RsbW | - |
P5657_RS00535 (P5657_00535) | 90862..91191 | - | 330 | WP_014475877.1 | anti-sigma factor antagonist RsbV | - |
P5657_RS00540 (P5657_00540) | 91260..92267 | - | 1008 | WP_134991884.1 | phosphoserine phosphatase RsbU | - |
P5657_RS00545 (P5657_00545) | 92279..92680 | - | 402 | WP_003225192.1 | serine/threonine-protein kinase RsbT | - |
P5657_RS00550 (P5657_00550) | 92684..93049 | - | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
P5657_RS00555 (P5657_00555) | 93054..93878 | - | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
P5657_RS00560 (P5657_00560) | 93994..94344 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P5657_RS00565 (P5657_00565) | 94349..94630 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
P5657_RS00570 (P5657_00570) | 94746..95915 | - | 1170 | WP_277710154.1 | alanine racemase | - |
P5657_RS00575 (P5657_00575) | 96029..97045 | - | 1017 | WP_072557167.1 | outer membrane lipoprotein carrier protein LolA | - |
P5657_RS00580 (P5657_00580) | 97211..97576 | - | 366 | WP_015252768.1 | holo-ACP synthase | - |
P5657_RS00585 (P5657_00585) | 97671..98270 | + | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T275273 WP_003156187.1 NZ_CP120621:c94344-93994 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|