Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 247161..247797 | Replicon | chromosome |
Accession | NZ_CP120618 | ||
Organism | Priestia megaterium strain DSM 1804 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | D5DWT4 |
Locus tag | P5632_RS01805 | Protein ID | WP_013055004.1 |
Coordinates | 247161..247511 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | D5DWT3 |
Locus tag | P5632_RS01810 | Protein ID | WP_013055003.1 |
Coordinates | 247516..247797 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5632_RS01770 (P5632_01770) | 242745..243539 | - | 795 | WP_013055011.1 | RNA polymerase sigma factor SigB | - |
P5632_RS01775 (P5632_01775) | 243505..243990 | - | 486 | WP_013055010.1 | anti-sigma B factor RsbW | - |
P5632_RS01780 (P5632_01780) | 243987..244319 | - | 333 | WP_013055009.1 | anti-sigma factor antagonist | - |
P5632_RS01785 (P5632_01785) | 244379..245389 | - | 1011 | WP_013055008.1 | PP2C family protein-serine/threonine phosphatase | - |
P5632_RS01790 (P5632_01790) | 245403..245804 | - | 402 | WP_013055007.1 | anti-sigma regulatory factor | - |
P5632_RS01795 (P5632_01795) | 245808..246164 | - | 357 | WP_013055006.1 | STAS domain-containing protein | - |
P5632_RS01800 (P5632_01800) | 246167..247003 | - | 837 | WP_013055005.1 | RsbT co-antagonist protein RsbRA | - |
P5632_RS01805 (P5632_01805) | 247161..247511 | - | 351 | WP_013055004.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P5632_RS01810 (P5632_01810) | 247516..247797 | - | 282 | WP_013055003.1 | hypothetical protein | Antitoxin |
P5632_RS01815 (P5632_01815) | 247998..249188 | - | 1191 | WP_013055002.1 | alanine racemase | - |
P5632_RS01820 (P5632_01820) | 249302..250360 | - | 1059 | WP_013055001.1 | outer membrane lipoprotein carrier protein LolA | - |
P5632_RS01825 (P5632_01825) | 250419..250784 | - | 366 | WP_013055000.1 | holo-ACP synthase | - |
P5632_RS01830 (P5632_01830) | 250849..251451 | + | 603 | WP_013054999.1 | rhomboid family intramembrane serine protease | - |
P5632_RS01835 (P5632_01835) | 251460..252431 | - | 972 | WP_013054998.1 | UV DNA damage repair endonuclease UvsE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12991.96 Da Isoelectric Point: 4.8781
>T275271 WP_013055004.1 NZ_CP120618:c247511-247161 [Priestia megaterium]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|