Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 3806944..3807860 | Replicon | chromosome |
Accession | NZ_CP120613 | ||
Organism | Bacillus subtilis strain DSM 23521 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | P5649_RS19865 | Protein ID | WP_003244695.1 |
Coordinates | 3806944..3807690 (+) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | P5649_RS19870 | Protein ID | WP_003232646.1 |
Coordinates | 3807690..3807860 (+) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5649_RS19840 (3802025) | 3802025..3802171 | - | 147 | WP_003244977.1 | hypothetical protein | - |
P5649_RS19845 (3802272) | 3802272..3803222 | - | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
P5649_RS19850 (3803611) | 3803611..3804927 | + | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
P5649_RS19855 (3805203) | 3805203..3805820 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
P5649_RS19860 (3805833) | 3805833..3806834 | + | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
P5649_RS19865 (3806944) | 3806944..3807690 | + | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
P5649_RS19870 (3807690) | 3807690..3807860 | + | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
P5649_RS19875 (3807946) | 3807946..3808083 | + | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
P5649_RS19880 (3808120) | 3808120..3809013 | - | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
P5649_RS19885 (3809026) | 3809026..3809289 | - | 264 | WP_003232653.1 | phage holin | - |
P5649_RS19890 (3809302) | 3809302..3809571 | - | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
P5649_RS19895 (3809624) | 3809624..3810463 | - | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
P5649_RS19900 (3810507) | 3810507..3810671 | - | 165 | WP_003232658.1 | XkdX family protein | - |
P5649_RS19905 (3810668) | 3810668..3810997 | - | 330 | WP_003232660.1 | XkdW family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T275270 WP_003244695.1 NZ_CP120613:3806944-3807690 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|