Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 432252..432888 | Replicon | chromosome |
Accession | NZ_CP120613 | ||
Organism | Bacillus subtilis strain DSM 23521 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | P5649_RS02245 | Protein ID | WP_003156187.1 |
Coordinates | 432252..432602 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | P5649_RS02250 | Protein ID | WP_003225183.1 |
Coordinates | 432607..432888 (-) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5649_RS02205 (427296) | 427296..427895 | - | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
P5649_RS02210 (427895) | 427895..428683 | - | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
P5649_RS02215 (428649) | 428649..429131 | - | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
P5649_RS02220 (429128) | 429128..429457 | - | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
P5649_RS02225 (429519) | 429519..430526 | - | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
P5649_RS02230 (430538) | 430538..430939 | - | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
P5649_RS02235 (430943) | 430943..431308 | - | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
P5649_RS02240 (431313) | 431313..432137 | - | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
P5649_RS02245 (432252) | 432252..432602 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P5649_RS02250 (432607) | 432607..432888 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
P5649_RS02255 (433004) | 433004..434173 | - | 1170 | WP_003234284.1 | alanine racemase | - |
P5649_RS02260 (434288) | 434288..435304 | - | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
P5649_RS02265 (435470) | 435470..435835 | - | 366 | WP_003234281.1 | holo-ACP synthase | - |
P5649_RS02270 (435930) | 435930..436529 | + | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T275250 WP_003156187.1 NZ_CP120613:c432602-432252 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|