Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/MazF(toxin)
Location 562184..562820 Replicon chromosome
Accession NZ_CP120610
Organism Bacillus paralicheniformis strain DSM 28591

Toxin (Protein)


Gene name mazF Uniprot ID M5P3Q9
Locus tag P5653_RS02810 Protein ID WP_003179128.1
Coordinates 562470..562820 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID M5PDU2
Locus tag P5653_RS02805 Protein ID WP_006638778.1
Coordinates 562184..562465 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5653_RS02785 (P5653_02785) 557294..558778 + 1485 WP_043054080.1 PH domain-containing protein -
P5653_RS02790 (P5653_02790) 558775..559374 - 600 WP_020450255.1 rhomboid family intramembrane serine protease -
P5653_RS02795 (P5653_02795) 559718..560677 + 960 WP_165395380.1 outer membrane lipoprotein carrier protein LolA -
P5653_RS02800 (P5653_02800) 560903..562072 + 1170 WP_023857864.1 alanine racemase -
P5653_RS02805 (P5653_02805) 562184..562465 + 282 WP_006638778.1 hypothetical protein Antitoxin
P5653_RS02810 (P5653_02810) 562470..562820 + 351 WP_003179128.1 type II toxin-antitoxin system endoribonuclease NdoA Toxin
P5653_RS02815 (P5653_02815) 562938..563765 + 828 WP_023857863.1 RsbT co-antagonist protein RsbRA -
P5653_RS02820 (P5653_02820) 563769..564134 + 366 WP_031305225.1 STAS domain-containing protein -
P5653_RS02825 (P5653_02825) 564137..564538 + 402 WP_023857861.1 anti-sigma regulatory factor -
P5653_RS02830 (P5653_02830) 564549..565556 + 1008 WP_020450261.1 PP2C family protein-serine/threonine phosphatase -
P5653_RS02835 (P5653_02835) 565615..565941 + 327 WP_020450262.1 anti-sigma factor antagonist -
P5653_RS02840 (P5653_02840) 565941..566423 + 483 WP_020450263.1 anti-sigma B factor RsbW -
P5653_RS02845 (P5653_02845) 566389..567180 + 792 WP_023857858.1 RNA polymerase sigma factor SigB -
P5653_RS02850 (P5653_02850) 567177..567776 + 600 WP_023857857.1 PP2C family serine/threonine-protein phosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-113)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12990.03 Da        Isoelectric Point: 5.7234

>T275248 WP_003179128.1 NZ_CP120610:562470-562820 [Bacillus paralicheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF

Download         Length: 351 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10649.03 Da        Isoelectric Point: 4.6920

>AT275248 WP_006638778.1 NZ_CP120610:562184-562465 [Bacillus paralicheniformis]
MSESSATTEILIRLPEALVSELDGVVMQDNGSRNELIYQATKMYLRERKNRQIRESMRRGYMEMAKINLNISSEAQFAEY
EAENTVERLVSGG

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A6I7FHI4

Antitoxin

Source ID Structure
AlphaFold DB M5PDU2

References