Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazF-pemI/MazF(toxin)
Location 2600074..2600710 Replicon chromosome
Accession NZ_CP120609
Organism Priestia megaterium DSM 319

Toxin (Protein)


Gene name mazF Uniprot ID D5DWT4
Locus tag P5636_RS14030 Protein ID WP_013055004.1
Coordinates 2600360..2600710 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID D5DWT3
Locus tag P5636_RS14025 Protein ID WP_013055003.1
Coordinates 2600074..2600355 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5636_RS14000 (P5636_14000) 2595440..2596411 + 972 WP_013081416.1 UV DNA damage repair endonuclease UvsE -
P5636_RS14005 (P5636_14005) 2596420..2597022 - 603 WP_013081417.1 rhomboid family intramembrane serine protease -
P5636_RS14010 (P5636_14010) 2597087..2597452 + 366 WP_013081418.1 holo-ACP synthase -
P5636_RS14015 (P5636_14015) 2597511..2598569 + 1059 WP_013081419.1 outer membrane lipoprotein carrier protein LolA -
P5636_RS14020 (P5636_14020) 2598683..2599873 + 1191 WP_013081420.1 alanine racemase -
P5636_RS14025 (P5636_14025) 2600074..2600355 + 282 WP_013055003.1 hypothetical protein Antitoxin
P5636_RS14030 (P5636_14030) 2600360..2600710 + 351 WP_013055004.1 type II toxin-antitoxin system endoribonuclease NdoA Toxin
P5636_RS14035 (P5636_14035) 2600870..2601706 + 837 WP_013081421.1 RsbT co-antagonist protein RsbRA -
P5636_RS14040 (P5636_14040) 2601709..2602065 + 357 WP_013081422.1 STAS domain-containing protein -
P5636_RS14045 (P5636_14045) 2602069..2602470 + 402 WP_013055007.1 anti-sigma regulatory factor -
P5636_RS14050 (P5636_14050) 2602484..2603494 + 1011 WP_013055008.1 PP2C family protein-serine/threonine phosphatase -
P5636_RS14055 (P5636_14055) 2603554..2603886 + 333 WP_013055009.1 anti-sigma factor antagonist -
P5636_RS14060 (P5636_14060) 2603883..2604368 + 486 WP_013055010.1 anti-sigma B factor RsbW -
P5636_RS14065 (P5636_14065) 2604334..2605128 + 795 WP_013055011.1 RNA polymerase sigma factor SigB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(4-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12991.96 Da        Isoelectric Point: 4.8781

>T275247 WP_013055004.1 NZ_CP120609:2600360-2600710 [Priestia megaterium DSM 319]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF

Download         Length: 351 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10691.22 Da        Isoelectric Point: 8.5339

>AT275247 WP_013055003.1 NZ_CP120609:2600074-2600355 [Priestia megaterium DSM 319]
VSEASATTEILVRLPKNLVSELDLMVKQENGNRSDFIHQATKLYLRERKKRHIRESMRRGYMEMAKINLNIASEAFLAEY
EADHTVDRLVSGG

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0B6AMB9

References