Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 2600074..2600710 | Replicon | chromosome |
| Accession | NZ_CP120609 | ||
| Organism | Priestia megaterium DSM 319 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | D5DWT4 |
| Locus tag | P5636_RS14030 | Protein ID | WP_013055004.1 |
| Coordinates | 2600360..2600710 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | D5DWT3 |
| Locus tag | P5636_RS14025 | Protein ID | WP_013055003.1 |
| Coordinates | 2600074..2600355 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5636_RS14000 (P5636_14000) | 2595440..2596411 | + | 972 | WP_013081416.1 | UV DNA damage repair endonuclease UvsE | - |
| P5636_RS14005 (P5636_14005) | 2596420..2597022 | - | 603 | WP_013081417.1 | rhomboid family intramembrane serine protease | - |
| P5636_RS14010 (P5636_14010) | 2597087..2597452 | + | 366 | WP_013081418.1 | holo-ACP synthase | - |
| P5636_RS14015 (P5636_14015) | 2597511..2598569 | + | 1059 | WP_013081419.1 | outer membrane lipoprotein carrier protein LolA | - |
| P5636_RS14020 (P5636_14020) | 2598683..2599873 | + | 1191 | WP_013081420.1 | alanine racemase | - |
| P5636_RS14025 (P5636_14025) | 2600074..2600355 | + | 282 | WP_013055003.1 | hypothetical protein | Antitoxin |
| P5636_RS14030 (P5636_14030) | 2600360..2600710 | + | 351 | WP_013055004.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| P5636_RS14035 (P5636_14035) | 2600870..2601706 | + | 837 | WP_013081421.1 | RsbT co-antagonist protein RsbRA | - |
| P5636_RS14040 (P5636_14040) | 2601709..2602065 | + | 357 | WP_013081422.1 | STAS domain-containing protein | - |
| P5636_RS14045 (P5636_14045) | 2602069..2602470 | + | 402 | WP_013055007.1 | anti-sigma regulatory factor | - |
| P5636_RS14050 (P5636_14050) | 2602484..2603494 | + | 1011 | WP_013055008.1 | PP2C family protein-serine/threonine phosphatase | - |
| P5636_RS14055 (P5636_14055) | 2603554..2603886 | + | 333 | WP_013055009.1 | anti-sigma factor antagonist | - |
| P5636_RS14060 (P5636_14060) | 2603883..2604368 | + | 486 | WP_013055010.1 | anti-sigma B factor RsbW | - |
| P5636_RS14065 (P5636_14065) | 2604334..2605128 | + | 795 | WP_013055011.1 | RNA polymerase sigma factor SigB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12991.96 Da Isoelectric Point: 4.8781
>T275247 WP_013055004.1 NZ_CP120609:2600360-2600710 [Priestia megaterium DSM 319]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDEALQISVGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|