Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 4109763..4110399 | Replicon | chromosome |
| Accession | NZ_CP120601 | ||
| Organism | Bacillus paralicheniformis strain PRO109 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | M5P3Q9 |
| Locus tag | P5637_RS20995 | Protein ID | WP_003179128.1 |
| Coordinates | 4110049..4110399 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | M5PDU2 |
| Locus tag | P5637_RS20990 | Protein ID | WP_006638778.1 |
| Coordinates | 4109763..4110044 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5637_RS20970 (P5637_20970) | 4104875..4106358 | + | 1484 | Protein_4115 | PH domain-containing protein | - |
| P5637_RS20975 (P5637_20975) | 4106355..4106954 | - | 600 | WP_023857867.1 | rhomboid family intramembrane serine protease | - |
| P5637_RS20980 (P5637_20980) | 4107298..4108257 | + | 960 | WP_164468292.1 | outer membrane lipoprotein carrier protein LolA | - |
| P5637_RS20985 (P5637_20985) | 4108482..4109651 | + | 1170 | WP_023857864.1 | alanine racemase | - |
| P5637_RS20990 (P5637_20990) | 4109763..4110044 | + | 282 | WP_006638778.1 | hypothetical protein | Antitoxin |
| P5637_RS20995 (P5637_20995) | 4110049..4110399 | + | 351 | WP_003179128.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| P5637_RS21000 (P5637_21000) | 4110517..4111344 | + | 828 | WP_145685330.1 | RsbT co-antagonist protein RsbRA | - |
| P5637_RS21005 (P5637_21005) | 4111348..4111713 | + | 366 | WP_020450259.1 | STAS domain-containing protein | - |
| P5637_RS21010 (P5637_21010) | 4111716..4112117 | + | 402 | WP_020450260.1 | anti-sigma regulatory factor | - |
| P5637_RS21015 (P5637_21015) | 4112128..4113135 | + | 1008 | WP_020450261.1 | PP2C family protein-serine/threonine phosphatase | - |
| P5637_RS21020 (P5637_21020) | 4113194..4113520 | + | 327 | WP_020450262.1 | anti-sigma factor antagonist | - |
| P5637_RS21025 (P5637_21025) | 4113520..4114002 | + | 483 | WP_020450263.1 | anti-sigma B factor RsbW | - |
| P5637_RS21030 (P5637_21030) | 4113968..4114759 | + | 792 | WP_023857858.1 | RNA polymerase sigma factor SigB | - |
| P5637_RS21035 (P5637_21035) | 4114756..4115355 | + | 600 | WP_145685333.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12990.03 Da Isoelectric Point: 5.7234
>T275245 WP_003179128.1 NZ_CP120601:4110049-4110399 [Bacillus paralicheniformis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNNIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVNEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6I7FHI4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | M5PDU2 |