Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1419052..1419968 | Replicon | chromosome |
Accession | NZ_CP120600 | ||
Organism | Bacillus subtilis strain PRO112 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | P5661_RS07635 | Protein ID | WP_003244695.1 |
Coordinates | 1419222..1419968 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | P5661_RS07630 | Protein ID | WP_003232646.1 |
Coordinates | 1419052..1419222 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5661_RS07595 (P5661_07595) | 1415914..1416240 | + | 327 | WP_277709537.1 | XkdW family protein | - |
P5661_RS07600 (P5661_07600) | 1416237..1416401 | + | 165 | WP_014479563.1 | XkdX family protein | - |
P5661_RS07605 (P5661_07605) | 1416448..1417287 | + | 840 | WP_124073160.1 | phage-like element PBSX protein XepA | - |
P5661_RS07610 (P5661_07610) | 1417340..1417609 | + | 270 | WP_014479565.1 | hemolysin XhlA family protein | - |
P5661_RS07615 (P5661_07615) | 1417622..1417885 | + | 264 | WP_014479566.1 | phage holin | - |
P5661_RS07620 (P5661_07620) | 1417898..1418791 | + | 894 | WP_021479459.1 | N-acetylmuramoyl-L-alanine amidase | - |
P5661_RS07625 (P5661_07625) | 1418829..1418966 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
P5661_RS07630 (P5661_07630) | 1419052..1419222 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
P5661_RS07635 (P5661_07635) | 1419222..1419968 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
P5661_RS07640 (P5661_07640) | 1420078..1421079 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
P5661_RS07645 (P5661_07645) | 1421092..1421709 | - | 618 | WP_277709538.1 | DUF47 domain-containing protein | - |
P5661_RS07650 (P5661_07650) | 1421985..1423301 | - | 1317 | WP_042974295.1 | serine/threonine exchanger | - |
P5661_RS07655 (P5661_07655) | 1423690..1424640 | + | 951 | WP_015252261.1 | ring-cleaving dioxygenase | - |
P5661_RS07660 (P5661_07660) | 1424749..1424850 | + | 102 | Protein_1444 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T275244 WP_003244695.1 NZ_CP120600:c1419968-1419222 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|