Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 505186..505822 | Replicon | chromosome |
Accession | NZ_CP120600 | ||
Organism | Bacillus subtilis strain PRO112 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | P5661_RS02585 | Protein ID | WP_003156187.1 |
Coordinates | 505472..505822 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | P5661_RS02580 | Protein ID | WP_003225183.1 |
Coordinates | 505186..505467 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5661_RS02560 (P5661_02560) | 501546..502145 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
P5661_RS02565 (P5661_02565) | 502240..502605 | + | 366 | WP_003234281.1 | holo-ACP synthase | - |
P5661_RS02570 (P5661_02570) | 502771..503787 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
P5661_RS02575 (P5661_02575) | 503901..505070 | + | 1170 | WP_015252766.1 | alanine racemase | - |
P5661_RS02580 (P5661_02580) | 505186..505467 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
P5661_RS02585 (P5661_02585) | 505472..505822 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P5661_RS02590 (P5661_02590) | 505938..506762 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
P5661_RS02595 (P5661_02595) | 506767..507132 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
P5661_RS02600 (P5661_02600) | 507136..507537 | + | 402 | WP_003225192.1 | serine/threonine-protein kinase RsbT | - |
P5661_RS02605 (P5661_02605) | 507549..508556 | + | 1008 | WP_014478900.1 | phosphoserine phosphatase RsbU | - |
P5661_RS02610 (P5661_02610) | 508625..508954 | + | 330 | WP_014475877.1 | anti-sigma factor antagonist RsbV | - |
P5661_RS02615 (P5661_02615) | 508951..509433 | + | 483 | WP_021481702.1 | anti-sigma B factor RsbW | - |
P5661_RS02620 (P5661_02620) | 509399..510187 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
P5661_RS02625 (P5661_02625) | 510187..510786 | + | 600 | WP_021481701.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T275243 WP_003156187.1 NZ_CP120600:505472-505822 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|