Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 3431395..3432311 | Replicon | chromosome |
| Accession | NZ_CP120598 | ||
| Organism | Bacillus subtilis strain PRO115 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | P5622_RS17840 | Protein ID | WP_003244695.1 |
| Coordinates | 3431395..3432141 (+) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | P5622_RS17845 | Protein ID | WP_003232646.1 |
| Coordinates | 3432141..3432311 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5622_RS17815 (3426476) | 3426476..3426622 | - | 147 | WP_003244977.1 | hypothetical protein | - |
| P5622_RS17820 (3426723) | 3426723..3427673 | - | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
| P5622_RS17825 (3428062) | 3428062..3429378 | + | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
| P5622_RS17830 (3429654) | 3429654..3430271 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| P5622_RS17835 (3430284) | 3430284..3431285 | + | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
| P5622_RS17840 (3431395) | 3431395..3432141 | + | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| P5622_RS17845 (3432141) | 3432141..3432311 | + | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| P5622_RS17850 (3432397) | 3432397..3432534 | + | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| P5622_RS17855 (3432571) | 3432571..3433464 | - | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
| P5622_RS17860 (3433477) | 3433477..3433740 | - | 264 | WP_003232653.1 | phage holin | - |
| P5622_RS17865 (3433753) | 3433753..3434022 | - | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
| P5622_RS17870 (3434075) | 3434075..3434914 | - | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
| P5622_RS17875 (3434958) | 3434958..3435122 | - | 165 | WP_003232658.1 | XkdX family protein | - |
| P5622_RS17880 (3435119) | 3435119..3435448 | - | 330 | WP_003232660.1 | XkdW family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T275241 WP_003244695.1 NZ_CP120598:3431395-3432141 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|