Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 100424..101060 | Replicon | chromosome |
| Accession | NZ_CP120598 | ||
| Organism | Bacillus subtilis strain PRO115 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G4NU33 |
| Locus tag | P5622_RS00605 | Protein ID | WP_003156187.1 |
| Coordinates | 100424..100774 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | G4NU32 |
| Locus tag | P5622_RS00610 | Protein ID | WP_003225183.1 |
| Coordinates | 100779..101060 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5622_RS00565 (95468) | 95468..96067 | - | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
| P5622_RS00570 (96067) | 96067..96855 | - | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
| P5622_RS00575 (96821) | 96821..97303 | - | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
| P5622_RS00580 (97300) | 97300..97629 | - | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
| P5622_RS00585 (97691) | 97691..98698 | - | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
| P5622_RS00590 (98710) | 98710..99111 | - | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
| P5622_RS00595 (99115) | 99115..99480 | - | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
| P5622_RS00600 (99485) | 99485..100309 | - | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
| P5622_RS00605 (100424) | 100424..100774 | - | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| P5622_RS00610 (100779) | 100779..101060 | - | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
| P5622_RS00615 (101176) | 101176..102345 | - | 1170 | WP_003234284.1 | alanine racemase | - |
| P5622_RS00620 (102460) | 102460..103476 | - | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
| P5622_RS00625 (103642) | 103642..104007 | - | 366 | WP_003234281.1 | holo-ACP synthase | - |
| P5622_RS00630 (104102) | 104102..104701 | + | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T275234 WP_003156187.1 NZ_CP120598:c100774-100424 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|