Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 300972..301608 | Replicon | chromosome |
| Accession | NZ_CP120590 | ||
| Organism | Priestia flexa strain PRO116 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A0V8JQ27 |
| Locus tag | P5663_RS01550 | Protein ID | WP_025910606.1 |
| Coordinates | 300972..301322 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | A0A1N6ZQI9 |
| Locus tag | P5663_RS01555 | Protein ID | WP_025910605.1 |
| Coordinates | 301327..301608 (-) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5663_RS01515 (P5663_01515) | 296536..297330 | - | 795 | WP_025910613.1 | RNA polymerase sigma factor SigB | - |
| P5663_RS01520 (P5663_01520) | 297296..297781 | - | 486 | WP_277717110.1 | anti-sigma B factor RsbW | - |
| P5663_RS01525 (P5663_01525) | 297778..298110 | - | 333 | WP_025910611.1 | anti-sigma factor antagonist | - |
| P5663_RS01530 (P5663_01530) | 298173..299186 | - | 1014 | WP_076513562.1 | PP2C family protein-serine/threonine phosphatase | - |
| P5663_RS01535 (P5663_01535) | 299198..299599 | - | 402 | WP_025910609.1 | anti-sigma regulatory factor | - |
| P5663_RS01540 (P5663_01540) | 299603..299965 | - | 363 | WP_035321022.1 | STAS domain-containing protein | - |
| P5663_RS01545 (P5663_01545) | 299962..300798 | - | 837 | WP_277717111.1 | RsbT co-antagonist protein RsbRA | - |
| P5663_RS01550 (P5663_01550) | 300972..301322 | - | 351 | WP_025910606.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| P5663_RS01555 (P5663_01555) | 301327..301608 | - | 282 | WP_025910605.1 | hypothetical protein | Antitoxin |
| P5663_RS01560 (P5663_01560) | 301784..302956 | - | 1173 | WP_078990475.1 | alanine racemase | - |
| P5663_RS01565 (P5663_01565) | 303145..304161 | - | 1017 | WP_025910603.1 | outer membrane lipoprotein carrier protein LolA | - |
| P5663_RS01570 (P5663_01570) | 304275..304643 | - | 369 | WP_025910601.1 | holo-ACP synthase | - |
| P5663_RS01575 (P5663_01575) | 304735..305328 | + | 594 | WP_224840390.1 | rhomboid family intramembrane serine protease | - |
| P5663_RS01580 (P5663_01580) | 305364..306332 | - | 969 | WP_100346447.1 | UV DNA damage repair endonuclease UvsE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12948.94 Da Isoelectric Point: 5.1442
>T275232 WP_025910606.1 NZ_CP120590:c301322-300972 [Priestia flexa]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDDALQISVGLIDF
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDDALQISVGLIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V8JQ27 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1N6ZQI9 |