Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazF-pemI/MazF(toxin)
Location 300972..301608 Replicon chromosome
Accession NZ_CP120590
Organism Priestia flexa strain PRO116

Toxin (Protein)


Gene name mazF Uniprot ID A0A0V8JQ27
Locus tag P5663_RS01550 Protein ID WP_025910606.1
Coordinates 300972..301322 (-) Length 117 a.a.

Antitoxin (Protein)


Gene name pemI Uniprot ID A0A1N6ZQI9
Locus tag P5663_RS01555 Protein ID WP_025910605.1
Coordinates 301327..301608 (-) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5663_RS01515 (P5663_01515) 296536..297330 - 795 WP_025910613.1 RNA polymerase sigma factor SigB -
P5663_RS01520 (P5663_01520) 297296..297781 - 486 WP_277717110.1 anti-sigma B factor RsbW -
P5663_RS01525 (P5663_01525) 297778..298110 - 333 WP_025910611.1 anti-sigma factor antagonist -
P5663_RS01530 (P5663_01530) 298173..299186 - 1014 WP_076513562.1 PP2C family protein-serine/threonine phosphatase -
P5663_RS01535 (P5663_01535) 299198..299599 - 402 WP_025910609.1 anti-sigma regulatory factor -
P5663_RS01540 (P5663_01540) 299603..299965 - 363 WP_035321022.1 STAS domain-containing protein -
P5663_RS01545 (P5663_01545) 299962..300798 - 837 WP_277717111.1 RsbT co-antagonist protein RsbRA -
P5663_RS01550 (P5663_01550) 300972..301322 - 351 WP_025910606.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
P5663_RS01555 (P5663_01555) 301327..301608 - 282 WP_025910605.1 hypothetical protein Antitoxin
P5663_RS01560 (P5663_01560) 301784..302956 - 1173 WP_078990475.1 alanine racemase -
P5663_RS01565 (P5663_01565) 303145..304161 - 1017 WP_025910603.1 outer membrane lipoprotein carrier protein LolA -
P5663_RS01570 (P5663_01570) 304275..304643 - 369 WP_025910601.1 holo-ACP synthase -
P5663_RS01575 (P5663_01575) 304735..305328 + 594 WP_224840390.1 rhomboid family intramembrane serine protease -
P5663_RS01580 (P5663_01580) 305364..306332 - 969 WP_100346447.1 UV DNA damage repair endonuclease UvsE -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(4-110)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 12948.94 Da        Isoelectric Point: 5.1442

>T275232 WP_025910606.1 NZ_CP120590:c301322-300972 [Priestia flexa]
MVVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEINAKKYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDRVDDALQISVGLIDF

Download         Length: 351 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10654.20 Da        Isoelectric Point: 9.5610

>AT275232 WP_025910605.1 NZ_CP120590:c301608-301327 [Priestia flexa]
VSEASATTEILVRLPKNLVSELDLMVKQENGNRSEFIYQATKLYLRERKKRHIRESMRRGYMEMAKINLNIASEAFLAES
EANHTVDRLVSGG

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0V8JQ27

Antitoxin

Source ID Structure
AlphaFold DB A0A1N6ZQI9

References