Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1346971..1347887 | Replicon | chromosome |
Accession | NZ_CP120577 | ||
Organism | Bacillus subtilis strain PRO53 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | P5628_RS07155 | Protein ID | WP_003244695.1 |
Coordinates | 1347141..1347887 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | P5628_RS07150 | Protein ID | WP_003232646.1 |
Coordinates | 1346971..1347141 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5628_RS07115 (P5628_07115) | 1343833..1344159 | + | 327 | WP_277709537.1 | XkdW family protein | - |
P5628_RS07120 (P5628_07120) | 1344156..1344320 | + | 165 | WP_014479563.1 | XkdX family protein | - |
P5628_RS07125 (P5628_07125) | 1344367..1345206 | + | 840 | WP_124073160.1 | phage-like element PBSX protein XepA | - |
P5628_RS07130 (P5628_07130) | 1345259..1345528 | + | 270 | WP_014479565.1 | hemolysin XhlA family protein | - |
P5628_RS07135 (P5628_07135) | 1345541..1345804 | + | 264 | WP_014479566.1 | phage holin | - |
P5628_RS07140 (P5628_07140) | 1345817..1346710 | + | 894 | WP_021479459.1 | N-acetylmuramoyl-L-alanine amidase | - |
P5628_RS07145 (P5628_07145) | 1346748..1346885 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
P5628_RS07150 (P5628_07150) | 1346971..1347141 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
P5628_RS07155 (P5628_07155) | 1347141..1347887 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
P5628_RS07160 (P5628_07160) | 1347997..1348998 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
P5628_RS07165 (P5628_07165) | 1349011..1349628 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
P5628_RS07170 (P5628_07170) | 1349904..1351220 | - | 1317 | WP_042974295.1 | serine/threonine exchanger | - |
P5628_RS07175 (P5628_07175) | 1351609..1352559 | + | 951 | WP_015252261.1 | ring-cleaving dioxygenase | - |
P5628_RS07180 (P5628_07180) | 1352668..1352769 | + | 102 | Protein_1357 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1311504..1356288 | 44784 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T275231 WP_003244695.1 NZ_CP120577:c1347887-1347141 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|