Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 499582..500218 | Replicon | chromosome |
Accession | NZ_CP120577 | ||
Organism | Bacillus subtilis strain PRO53 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | P5628_RS02550 | Protein ID | WP_003156187.1 |
Coordinates | 499868..500218 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | P5628_RS02545 | Protein ID | WP_003225183.1 |
Coordinates | 499582..499863 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5628_RS02525 (P5628_02525) | 495942..496541 | - | 600 | WP_003246687.1 | rhomboid family intramembrane serine protease | - |
P5628_RS02530 (P5628_02530) | 496636..497001 | + | 366 | WP_003234281.1 | holo-ACP synthase | - |
P5628_RS02535 (P5628_02535) | 497167..498183 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
P5628_RS02540 (P5628_02540) | 498297..499466 | + | 1170 | WP_015252766.1 | alanine racemase | - |
P5628_RS02545 (P5628_02545) | 499582..499863 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
P5628_RS02550 (P5628_02550) | 499868..500218 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
P5628_RS02555 (P5628_02555) | 500334..501158 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
P5628_RS02560 (P5628_02560) | 501163..501528 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
P5628_RS02565 (P5628_02565) | 501532..501933 | + | 402 | WP_003225192.1 | serine/threonine-protein kinase RsbT | - |
P5628_RS02570 (P5628_02570) | 501945..502952 | + | 1008 | WP_014478900.1 | phosphoserine phosphatase RsbU | - |
P5628_RS02575 (P5628_02575) | 503021..503350 | + | 330 | WP_014475877.1 | anti-sigma factor antagonist RsbV | - |
P5628_RS02580 (P5628_02580) | 503347..503829 | + | 483 | WP_021481702.1 | anti-sigma B factor RsbW | - |
P5628_RS02585 (P5628_02585) | 503795..504583 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
P5628_RS02590 (P5628_02590) | 504583..505182 | + | 600 | WP_021481701.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T275230 WP_003156187.1 NZ_CP120577:499868-500218 [Bacillus subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|