Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 72307..72932 | Replicon | plasmid p582_124850 |
| Accession | NZ_CP120569 | ||
| Organism | Escherichia coli strain 582 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | P5711_RS24165 | Protein ID | WP_000911313.1 |
| Coordinates | 72534..72932 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V0VCB2 |
| Locus tag | P5711_RS24160 | Protein ID | WP_000450520.1 |
| Coordinates | 72307..72534 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5711_RS24160 (72307) | 72307..72534 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| P5711_RS24165 (72534) | 72534..72932 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| P5711_RS24170 (72941) | 72941..75175 | - | 2235 | WP_089078723.1 | type IV conjugative transfer system coupling protein TraD | - |
| P5711_RS24175 (75428) | 75428..76159 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
| P5711_RS24180 (76191) | 76191..76688 | - | 498 | WP_000605857.1 | entry exclusion protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iroB / iroC / iroD / iroE / iroN / vat | 1..124850 | 124850 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T275226 WP_000911313.1 NZ_CP120569:72534-72932 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|