Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3657084..3657702 | Replicon | chromosome |
Accession | NZ_CP120568 | ||
Organism | Escherichia coli strain 582 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | P5711_RS18045 | Protein ID | WP_001291435.1 |
Coordinates | 3657484..3657702 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | P5711_RS18040 | Protein ID | WP_000344800.1 |
Coordinates | 3657084..3657458 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5711_RS18030 (3652173) | 3652173..3653366 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P5711_RS18035 (3653389) | 3653389..3656538 | + | 3150 | WP_046952227.1 | efflux RND transporter permease AcrB | - |
P5711_RS18040 (3657084) | 3657084..3657458 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
P5711_RS18045 (3657484) | 3657484..3657702 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
P5711_RS18050 (3657874) | 3657874..3658425 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
P5711_RS18055 (3658541) | 3658541..3659011 | + | 471 | WP_000136192.1 | YlaC family protein | - |
P5711_RS18060 (3659175) | 3659175..3660725 | + | 1551 | WP_001310610.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
P5711_RS18065 (3660767) | 3660767..3661120 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
P5711_RS18075 (3661499) | 3661499..3661810 | + | 312 | WP_000409911.1 | MGMT family protein | - |
P5711_RS18080 (3661841) | 3661841..3662413 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T275217 WP_001291435.1 NZ_CP120568:3657484-3657702 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT275217 WP_000344800.1 NZ_CP120568:3657084-3657458 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |