Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2542890..2543528 | Replicon | chromosome |
Accession | NZ_CP120568 | ||
Organism | Escherichia coli strain 582 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | P5711_RS12410 | Protein ID | WP_000813794.1 |
Coordinates | 2543352..2543528 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | P5711_RS12405 | Protein ID | WP_001270286.1 |
Coordinates | 2542890..2543306 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5711_RS12385 (2538042) | 2538042..2538983 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
P5711_RS12390 (2538984) | 2538984..2539997 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
P5711_RS12395 (2540015) | 2540015..2541160 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
P5711_RS12400 (2541405) | 2541405..2542811 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
P5711_RS12405 (2542890) | 2542890..2543306 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
P5711_RS12410 (2543352) | 2543352..2543528 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
P5711_RS12415 (2543750) | 2543750..2543980 | + | 231 | WP_000494244.1 | YncJ family protein | - |
P5711_RS12420 (2544072) | 2544072..2546033 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
P5711_RS12425 (2546106) | 2546106..2546642 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
P5711_RS12430 (2546734) | 2546734..2546895 | + | 162 | Protein_2431 | benzoate/H(+) symporter BenE family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T275216 WP_000813794.1 NZ_CP120568:c2543528-2543352 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT275216 WP_001270286.1 NZ_CP120568:c2543306-2542890 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|