Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1072861..1073444 | Replicon | chromosome |
Accession | NZ_CP120568 | ||
Organism | Escherichia coli strain 582 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | S1EZP4 |
Locus tag | P5711_RS05220 | Protein ID | WP_000254738.1 |
Coordinates | 1073109..1073444 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | P5711_RS05215 | Protein ID | WP_000581937.1 |
Coordinates | 1072861..1073109 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5711_RS05205 (1069200) | 1069200..1070501 | + | 1302 | WP_000046812.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
P5711_RS05210 (1070549) | 1070549..1072783 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
P5711_RS05215 (1072861) | 1072861..1073109 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
P5711_RS05220 (1073109) | 1073109..1073444 | + | 336 | WP_000254738.1 | endoribonuclease MazF | Toxin |
P5711_RS05225 (1073515) | 1073515..1074306 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
P5711_RS05230 (1074534) | 1074534..1076171 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
P5711_RS05235 (1076259) | 1076259..1077557 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1077683..1079011 | 1328 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12098.04 Da Isoelectric Point: 8.2618
>T275209 WP_000254738.1 NZ_CP120568:1073109-1073444 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|