Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 925677..926331 | Replicon | chromosome |
Accession | NZ_CP120568 | ||
Organism | Escherichia coli strain 582 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | P5711_RS04545 | Protein ID | WP_000244781.1 |
Coordinates | 925924..926331 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | P5711_RS04540 | Protein ID | WP_000354046.1 |
Coordinates | 925677..925943 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5711_RS04515 (920965) | 920965..921708 | + | 744 | WP_000951964.1 | SDR family oxidoreductase | - |
P5711_RS04520 (921765) | 921765..923198 | - | 1434 | WP_046952425.1 | 6-phospho-beta-glucosidase BglA | - |
P5711_RS04525 (923243) | 923243..923554 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
P5711_RS04530 (923718) | 923718..924377 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
P5711_RS04535 (924454) | 924454..925434 | - | 981 | WP_000886083.1 | tRNA-modifying protein YgfZ | - |
P5711_RS04540 (925677) | 925677..925943 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
P5711_RS04545 (925924) | 925924..926331 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
P5711_RS04550 (926371) | 926371..926892 | - | 522 | WP_044863754.1 | flavodoxin FldB | - |
P5711_RS04555 (927004) | 927004..927900 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
P5711_RS04560 (927925) | 927925..928635 | + | 711 | WP_000715214.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P5711_RS04565 (928641) | 928641..930374 | + | 1734 | WP_000813201.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T275208 WP_000244781.1 NZ_CP120568:925924-926331 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|