Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4596741..4597576 | Replicon | chromosome |
| Accession | NZ_CP120567 | ||
| Organism | Escherichia coli strain A0 34/86 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | P5707_RS22305 | Protein ID | WP_001094425.1 |
| Coordinates | 4596741..4597118 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | Q1R2L5 |
| Locus tag | P5707_RS22310 | Protein ID | WP_001285575.1 |
| Coordinates | 4597208..4597576 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5707_RS22280 (4592243) | 4592243..4592422 | + | 180 | Protein_4355 | peptidase | - |
| P5707_RS22285 (4592821) | 4592821..4594857 | - | 2037 | WP_021561045.1 | hypothetical protein | - |
| P5707_RS22290 (4595813) | 4595813..4595962 | - | 150 | Protein_4357 | hypothetical protein | - |
| P5707_RS22295 (4596047) | 4596047..4596244 | - | 198 | WP_000839272.1 | DUF957 domain-containing protein | - |
| P5707_RS22300 (4596256) | 4596256..4596744 | - | 489 | WP_000761683.1 | DUF5983 family protein | - |
| P5707_RS22305 (4596741) | 4596741..4597118 | - | 378 | WP_001094425.1 | TA system toxin CbtA family protein | Toxin |
| P5707_RS22310 (4597208) | 4597208..4597576 | - | 369 | WP_001285575.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P5707_RS22315 (4597656) | 4597656..4597877 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| P5707_RS22320 (4597964) | 4597964..4598440 | - | 477 | WP_001186771.1 | RadC family protein | - |
| P5707_RS22325 (4598456) | 4598456..4598941 | - | 486 | WP_000206654.1 | antirestriction protein | - |
| P5707_RS22330 (4599033) | 4599033..4599851 | - | 819 | WP_001175163.1 | DUF932 domain-containing protein | - |
| P5707_RS22335 (4599941) | 4599941..4600174 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| P5707_RS22340 (4600180) | 4600180..4600857 | - | 678 | WP_021520461.1 | hypothetical protein | - |
| P5707_RS22345 (4601008) | 4601008..4601688 | - | 681 | WP_112065092.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimB / hlyC / hlyA / hlyB / hlyD / cnf1 / papI / papB / papA / papH / papC / papD / papJ / papK / papE / papF / papX | 4586160..4686530 | 100370 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14058.97 Da Isoelectric Point: 7.3523
>T275203 WP_001094425.1 NZ_CP120567:c4597118-4596741 [Escherichia coli]
MNTLPDTHIREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACSRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MNTLPDTHIREASHCQSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACSRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13709.52 Da Isoelectric Point: 6.6258
>AT275203 WP_001285575.1 NZ_CP120567:c4597576-4597208 [Escherichia coli]
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
VSDTLPGTTHPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKRLTCEADTLGSCGYVYMAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|