Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4420241..4420791 Replicon chromosome
Accession NZ_CP120567
Organism Escherichia coli strain A0 34/86

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag P5707_RS21470 Protein ID WP_001160966.1
Coordinates 4420241..4420555 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag P5707_RS21475 Protein ID WP_000125566.1
Coordinates 4420558..4420791 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5707_RS21445 (4415916) 4415916..4417202 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
P5707_RS21450 (4417202) 4417202..4418191 + 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
P5707_RS21455 (4418188) 4418188..4419009 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
P5707_RS21460 (4419012) 4419012..4419389 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
P5707_RS21465 (4419396) 4419396..4420244 + 849 WP_000257182.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
P5707_RS21470 (4420241) 4420241..4420555 - 315 WP_001160966.1 CcdB family protein Toxin
P5707_RS21475 (4420558) 4420558..4420791 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
P5707_RS21480 (4420877) 4420877..4421356 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
P5707_RS21485 (4421548) 4421548..4423410 - 1863 WP_021520423.1 glutathione-regulated potassium-efflux system protein KefC -
P5707_RS21490 (4423403) 4423403..4423933 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
P5707_RS21495 (4424041) 4424041..4425372 - 1332 WP_021520424.1 MFS transporter -
P5707_RS21500 (4425431) 4425431..4425718 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T275198 WP_001160966.1 NZ_CP120567:c4420555-4420241 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT275198 WP_000125566.1 NZ_CP120567:c4420791-4420558 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References