Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3940348..3940966 | Replicon | chromosome |
Accession | NZ_CP120567 | ||
Organism | Escherichia coli strain A0 34/86 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | P5707_RS19180 | Protein ID | WP_001291435.1 |
Coordinates | 3940748..3940966 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | P5707_RS19175 | Protein ID | WP_000344800.1 |
Coordinates | 3940348..3940722 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5707_RS19165 (3935438) | 3935438..3936631 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P5707_RS19170 (3936654) | 3936654..3939803 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
P5707_RS19175 (3940348) | 3940348..3940722 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
P5707_RS19180 (3940748) | 3940748..3940966 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
P5707_RS19185 (3941140) | 3941140..3941691 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
P5707_RS19190 (3941807) | 3941807..3942277 | + | 471 | WP_000136192.1 | YlaC family protein | - |
P5707_RS19195 (3942441) | 3942441..3943991 | + | 1551 | WP_001298569.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
P5707_RS19200 (3944033) | 3944033..3944386 | - | 354 | WP_000878138.1 | DUF1428 family protein | - |
P5707_RS19210 (3944765) | 3944765..3945076 | + | 312 | WP_000409908.1 | MGMT family protein | - |
P5707_RS19215 (3945107) | 3945107..3945679 | - | 573 | WP_000779830.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T275196 WP_001291435.1 NZ_CP120567:3940748-3940966 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT275196 WP_000344800.1 NZ_CP120567:3940348-3940722 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |