Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3432853..3433654 | Replicon | chromosome |
| Accession | NZ_CP120567 | ||
| Organism | Escherichia coli strain A0 34/86 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0H2V687 |
| Locus tag | P5707_RS16730 | Protein ID | WP_000854739.1 |
| Coordinates | 3432853..3433233 (-) | Length | 127 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0P7R0L9 |
| Locus tag | P5707_RS16735 | Protein ID | WP_001285482.1 |
| Coordinates | 3433280..3433654 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5707_RS16700 (3429525) | 3429525..3430229 | + | 705 | WP_001241673.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
| P5707_RS16705 (3430514) | 3430514..3430732 | + | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
| P5707_RS16715 (3431223) | 3431223..3432066 | - | 844 | Protein_3270 | DUF4942 domain-containing protein | - |
| P5707_RS16720 (3432151) | 3432151..3432348 | - | 198 | WP_000772027.1 | DUF957 domain-containing protein | - |
| P5707_RS16725 (3432368) | 3432368..3432856 | - | 489 | WP_001054232.1 | DUF5983 family protein | - |
| P5707_RS16730 (3432853) | 3432853..3433233 | - | 381 | WP_000854739.1 | TA system toxin CbtA family protein | Toxin |
| P5707_RS16735 (3433280) | 3433280..3433654 | - | 375 | WP_001285482.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P5707_RS16740 (3433704) | 3433704..3434348 | - | 645 | WP_000086763.1 | hypothetical protein | - |
| P5707_RS16745 (3434367) | 3434367..3434588 | - | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| P5707_RS16750 (3434651) | 3434651..3435127 | - | 477 | WP_001186774.1 | RadC family protein | - |
| P5707_RS16755 (3435143) | 3435143..3435616 | - | 474 | WP_001608999.1 | antirestriction protein | - |
| P5707_RS16760 (3435879) | 3435879..3436700 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| P5707_RS16765 (3436879) | 3436879..3436968 | - | 90 | WP_112031555.1 | DUF905 family protein | - |
| P5707_RS16770 (3437111) | 3437111..3437566 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 14214.14 Da Isoelectric Point: 6.4773
>T275194 WP_000854739.1 NZ_CP120567:c3433233-3432853 [Escherichia coli]
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGVPSQLINSIDILRARRATGLMTRDNYRTVNDITLGRHPEEAKQ
Download Length: 381 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13791.44 Da Isoelectric Point: 4.7511
>AT275194 WP_001285482.1 NZ_CP120567:c3433654-3433280 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H2V687 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P7R0L9 |