Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
Location | 1501881..1502539 | Replicon | chromosome |
Accession | NZ_CP120567 | ||
Organism | Escherichia coli strain A0 34/86 |
Toxin (Protein)
Gene name | ypjF | Uniprot ID | - |
Locus tag | P5707_RS07165 | Protein ID | WP_021520983.1 |
Coordinates | 1501881..1502201 (-) | Length | 107 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | P5707_RS07170 | Protein ID | WP_021520982.1 |
Coordinates | 1502222..1502539 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5707_RS07150 (1497303) | 1497303..1498751 | - | 1449 | WP_000772886.1 | NADP-dependent succinate-semialdehyde dehydrogenase | - |
P5707_RS07155 (1498774) | 1498774..1500042 | - | 1269 | WP_000271981.1 | L-2-hydroxyglutarate oxidase | - |
P5707_RS07160 (1500062) | 1500062..1501039 | - | 978 | WP_021520984.1 | glutarate dioxygenase GlaH | - |
P5707_RS07165 (1501881) | 1501881..1502201 | - | 321 | WP_021520983.1 | TA system toxin CbtA family protein | Toxin |
P5707_RS07170 (1502222) | 1502222..1502539 | - | 318 | WP_021520982.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
P5707_RS07175 (1502558) | 1502558..1502779 | - | 222 | WP_021520981.1 | DUF987 domain-containing protein | - |
P5707_RS07180 (1502788) | 1502788..1503264 | - | 477 | WP_021520980.1 | RadC family protein | - |
P5707_RS07185 (1503280) | 1503280..1503738 | - | 459 | WP_021520979.1 | antirestriction protein | - |
P5707_RS07190 (1503834) | 1503834..1504073 | - | 240 | WP_021520978.1 | DUF905 domain-containing protein | - |
P5707_RS07195 (1504173) | 1504173..1505081 | - | 909 | WP_021520977.1 | Ivy family c-type lysozyme inhibitor | - |
P5707_RS07200 (1505150) | 1505150..1505317 | - | 168 | Protein_1398 | DUF4339 domain-containing protein | - |
P5707_RS07205 (1505355) | 1505355..1506050 | - | 696 | WP_021520976.1 | hypothetical protein | - |
P5707_RS07210 (1506277) | 1506277..1507104 | - | 828 | WP_021520975.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 107 a.a. Molecular weight: 12162.18 Da Isoelectric Point: 7.1656
>T275186 WP_021520983.1 NZ_CP120567:c1502201-1501881 [Escherichia coli]
MKTLPATTLWAAKPCLSPVIVWQMLLSRLLDQHYGLTLNDTPFSDETVIKEHIDAGISLADAVNFLVEKYELVRIDRKGF
SWQEQSPFITAVDILKARRAMREMRT
MKTLPATTLWAAKPCLSPVIVWQMLLSRLLDQHYGLTLNDTPFSDETVIKEHIDAGISLADAVNFLVEKYELVRIDRKGF
SWQEQSPFITAVDILKARRAMREMRT
Download Length: 321 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|