Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1381558..1382141 | Replicon | chromosome |
Accession | NZ_CP120567 | ||
Organism | Escherichia coli strain A0 34/86 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | V0SV58 |
Locus tag | P5707_RS06540 | Protein ID | WP_000254750.1 |
Coordinates | 1381806..1382141 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | P5707_RS06535 | Protein ID | WP_000581937.1 |
Coordinates | 1381558..1381806 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5707_RS06525 (1377897) | 1377897..1379198 | + | 1302 | WP_000046817.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
P5707_RS06530 (1379246) | 1379246..1381480 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
P5707_RS06535 (1381558) | 1381558..1381806 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
P5707_RS06540 (1381806) | 1381806..1382141 | + | 336 | WP_000254750.1 | endoribonuclease MazF | Toxin |
P5707_RS06545 (1382213) | 1382213..1383004 | + | 792 | WP_001071677.1 | nucleoside triphosphate pyrophosphohydrolase | - |
P5707_RS06550 (1383232) | 1383232..1384869 | + | 1638 | WP_000210888.1 | CTP synthase (glutamine hydrolyzing) | - |
P5707_RS06555 (1384957) | 1384957..1386255 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12067.95 Da Isoelectric Point: 8.2618
>T275185 WP_000254750.1 NZ_CP120567:1381806-1382141 [Escherichia coli]
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDTGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SV58 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9LMB4 |