Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1228942..1229581 | Replicon | chromosome |
Accession | NZ_CP120567 | ||
Organism | Escherichia coli strain A0 34/86 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | P5707_RS05915 | Protein ID | WP_021521010.1 |
Coordinates | 1229189..1229581 (+) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | P5707_RS05910 | Protein ID | WP_000354046.1 |
Coordinates | 1228942..1229208 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5707_RS05890 (1225030) | 1225030..1226463 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
P5707_RS05895 (1226508) | 1226508..1226819 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
P5707_RS05900 (1226983) | 1226983..1227642 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
P5707_RS05905 (1227719) | 1227719..1228699 | - | 981 | WP_000886078.1 | tRNA-modifying protein YgfZ | - |
P5707_RS05910 (1228942) | 1228942..1229208 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
P5707_RS05915 (1229189) | 1229189..1229581 | + | 393 | WP_021521010.1 | protein YgfX | Toxin |
P5707_RS05920 (1229636) | 1229636..1230157 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
P5707_RS05925 (1230269) | 1230269..1231165 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
P5707_RS05930 (1231190) | 1231190..1231900 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P5707_RS05935 (1231906) | 1231906..1233639 | + | 1734 | WP_021521009.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 15419.32 Da Isoelectric Point: 11.5439
>T275184 WP_021521010.1 NZ_CP120567:1229189-1229581 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQ
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQ
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|