Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 1081781..1082579 | Replicon | chromosome |
Accession | NZ_CP120567 | ||
Organism | Escherichia coli strain A0 34/86 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | P5707_RS05190 | Protein ID | WP_057916008.1 |
Coordinates | 1081781..1082158 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | A0A1L4NTN5 |
Locus tag | P5707_RS05195 | Protein ID | WP_001605875.1 |
Coordinates | 1082205..1082579 (-) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5707_RS05160 (1076909) | 1076909..1078057 | - | 1149 | WP_000905920.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
P5707_RS05165 (1078129) | 1078129..1079112 | - | 984 | WP_001336760.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
P5707_RS05170 (1079923) | 1079923..1080093 | - | 171 | Protein_1005 | IS110 family transposase | - |
P5707_RS05175 (1080435) | 1080435..1081277 | - | 843 | WP_112065071.1 | DUF4942 domain-containing protein | - |
P5707_RS05180 (1081362) | 1081362..1081559 | - | 198 | WP_112065078.1 | DUF957 domain-containing protein | - |
P5707_RS05185 (1081635) | 1081635..1081784 | - | 150 | Protein_1008 | DUF5983 family protein | - |
P5707_RS05190 (1081781) | 1081781..1082158 | - | 378 | WP_057916008.1 | TA system toxin CbtA family protein | Toxin |
P5707_RS05195 (1082205) | 1082205..1082579 | - | 375 | WP_001605875.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
P5707_RS05200 (1082653) | 1082653..1082874 | - | 222 | WP_000692303.1 | DUF987 domain-containing protein | - |
P5707_RS05205 (1082943) | 1082943..1083419 | - | 477 | WP_057916007.1 | RadC family protein | - |
P5707_RS05210 (1083435) | 1083435..1083920 | - | 486 | WP_001536436.1 | antirestriction protein | - |
P5707_RS05215 (1084012) | 1084012..1084830 | - | 819 | WP_001234393.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14140.14 Da Isoelectric Point: 7.2652
>T275183 WP_057916008.1 NZ_CP120567:c1082158-1081781 [Escherichia coli]
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATSLMTRDNYRTVNNITLGKHPEAKQ
MKTLPDTHVREASCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATSLMTRDNYRTVNNITLGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13594.42 Da Isoelectric Point: 5.4554
>AT275183 WP_001605875.1 NZ_CP120567:c1082579-1082205 [Escherichia coli]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLACEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|