Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 67091..67716 | Replicon | plasmid pH22_122286 |
Accession | NZ_CP120564 | ||
Organism | Escherichia coli strain H22 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | P5708_RS24920 | Protein ID | WP_000911317.1 |
Coordinates | 67318..67716 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | L4J1D2 |
Locus tag | P5708_RS24915 | Protein ID | WP_000450532.1 |
Coordinates | 67091..67318 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5708_RS24915 (67091) | 67091..67318 | + | 228 | WP_000450532.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
P5708_RS24920 (67318) | 67318..67716 | + | 399 | WP_000911317.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
P5708_RS24925 (67725) | 67725..69878 | - | 2154 | WP_024186499.1 | type IV conjugative transfer system coupling protein TraD | - |
P5708_RS24930 (70104) | 70104..70892 | - | 789 | WP_019842748.1 | hypothetical protein | - |
P5708_RS24935 (71102) | 71102..71413 | + | 312 | WP_019842747.1 | heavy metal-binding domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | iroB / iroC / iroD / iroE / iroN / papD / papC | 1..122286 | 122286 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14857.14 Da Isoelectric Point: 8.5264
>T275176 WP_000911317.1 NZ_CP120564:67318-67716 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVGGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|