Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 55535..56094 Replicon plasmid pH22_122286
Accession NZ_CP120564
Organism Escherichia coli strain H22

Toxin (Protein)


Gene name relE Uniprot ID S1PMX5
Locus tag P5708_RS24850 Protein ID WP_000421257.1
Coordinates 55535..55810 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID A0A827YCB8
Locus tag P5708_RS24855 Protein ID WP_024186511.1
Coordinates 55810..56094 (-) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5708_RS24825 (51313) 51313..52068 + 756 WP_019842810.1 SDR family NAD(P)-dependent oxidoreductase -
P5708_RS24830 (52106) 52106..53044 + 939 WP_019842809.1 alpha/beta hydrolase -
P5708_RS24835 (53267) 53267..53419 - 153 Protein_56 hypothetical protein -
P5708_RS24840 (53501) 53501..54283 - 783 WP_277705727.1 IS21-like element IS100kyp family helper ATPase IstB -
P5708_RS24845 (54280) 54280..55302 - 1023 WP_277705726.1 IS21-like element IS100 family transposase -
P5708_RS24850 (55535) 55535..55810 - 276 WP_000421257.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P5708_RS24855 (55810) 55810..56094 - 285 WP_024186511.1 ribbon-helix-helix domain-containing protein Antitoxin
P5708_RS24860 (57007) 57007..57864 - 858 WP_019842754.1 incFII family plasmid replication initiator RepA -
P5708_RS24865 (57857) 57857..58339 - 483 WP_019842753.1 hypothetical protein -
P5708_RS24870 (58332) 58332..58379 - 48 WP_229471593.1 hypothetical protein -
P5708_RS24875 (58370) 58370..58621 + 252 WP_223195197.1 replication protein RepA -
P5708_RS24880 (58638) 58638..58895 - 258 WP_000083845.1 replication regulatory protein RepA -
P5708_RS24885 (59179) 59179..59328 - 150 WP_001312851.1 Hok/Gef family protein -
- (59372) 59372..59433 + 62 NuclAT_1 - -
- (59372) 59372..59433 + 62 NuclAT_1 - -
- (59372) 59372..59433 + 62 NuclAT_1 - -
- (59372) 59372..59433 + 62 NuclAT_1 - -
P5708_RS24890 (59690) 59690..59764 - 75 Protein_67 endonuclease -
P5708_RS24895 (60010) 60010..60222 - 213 WP_001299730.1 ANR family transcriptional regulator -
P5708_RS24900 (60358) 60358..60918 - 561 WP_019842752.1 fertility inhibition protein FinO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - iroB / iroC / iroD / iroE / iroN / papD / papC 1..122286 122286


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 9.9324

>T275174 WP_000421257.1 NZ_CP120564:c55810-55535 [Escherichia coli]
MELKWTSKALSDLARLYDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYELNGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10502.95 Da        Isoelectric Point: 5.6558

>AT275174 WP_024186511.1 NZ_CP120564:c56094-55810 [Escherichia coli]
MQMKNNTAQATKVITAHVPLPMADKVDQMAARLERSRGWIIKQALSAWLAQEEERNRLTLEALDDVTSGQIIDHQAVQAW
ADSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PMX5

Antitoxin

Source ID Structure
AlphaFold DB A0A827YCB8

References