Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4500315..4501150 | Replicon | chromosome |
Accession | NZ_CP120563 | ||
Organism | Escherichia coli strain H22 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | P5708_RS22145 | Protein ID | WP_019842394.1 |
Coordinates | 4500773..4501150 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | P5708_RS22140 | Protein ID | WP_024186453.1 |
Coordinates | 4500315..4500683 (+) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5708_RS22115 (4497740) | 4497740..4497973 | + | 234 | WP_001117568.1 | DUF905 family protein | - |
P5708_RS22120 (4498064) | 4498064..4498882 | + | 819 | WP_019842398.1 | DUF932 domain-containing protein | - |
P5708_RS22125 (4498974) | 4498974..4499459 | + | 486 | WP_019842397.1 | antirestriction protein | - |
P5708_RS22130 (4499475) | 4499475..4499951 | + | 477 | WP_019842396.1 | RadC family protein | - |
P5708_RS22135 (4500020) | 4500020..4500241 | + | 222 | WP_000692346.1 | DUF987 domain-containing protein | - |
P5708_RS22140 (4500315) | 4500315..4500683 | + | 369 | WP_024186453.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
P5708_RS22145 (4500773) | 4500773..4501150 | + | 378 | WP_019842394.1 | TA system toxin CbtA family protein | Toxin |
P5708_RS22150 (4501147) | 4501147..4501635 | + | 489 | WP_019842393.1 | DUF5983 family protein | - |
P5708_RS22155 (4501652) | 4501652..4501828 | + | 177 | WP_033876239.1 | DUF957 domain-containing protein | - |
P5708_RS22160 (4501934) | 4501934..4502776 | + | 843 | WP_097340774.1 | DUF4942 domain-containing protein | - |
P5708_RS22165 (4503525) | 4503525..4505063 | + | 1539 | WP_001187191.1 | lysine decarboxylation/transport transcriptional activator CadC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4492608..4512876 | 20268 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14176.11 Da Isoelectric Point: 7.2920
>T275170 WP_019842394.1 NZ_CP120563:4500773-4501150 [Escherichia coli]
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRAIGLMTRDNYRTVNNITQGKHPEAKQ
MNTLPDTHVREASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRAIGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13588.37 Da Isoelectric Point: 7.0265
>AT275170 WP_024186453.1 NZ_CP120563:4500315-4500683 [Escherichia coli]
VSDTLPGTTHPDDNHDRLRWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTQYAKGLTCEADTLGSCGYVYLAVYPTPETKT
VSDTLPGTTHPDDNHDRLRWGLPCTVTPCFGARLVQKGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTQYAKGLTCEADTLGSCGYVYLAVYPTPETKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|