Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3587686..3588304 | Replicon | chromosome |
Accession | NZ_CP120563 | ||
Organism | Escherichia coli strain H22 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | P5708_RS17710 | Protein ID | WP_001291435.1 |
Coordinates | 3588086..3588304 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | P5708_RS17705 | Protein ID | WP_000344800.1 |
Coordinates | 3587686..3588060 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5708_RS17695 (3582776) | 3582776..3583969 | + | 1194 | WP_001538394.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
P5708_RS17700 (3583992) | 3583992..3587141 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
P5708_RS17705 (3587686) | 3587686..3588060 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
P5708_RS17710 (3588086) | 3588086..3588304 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
P5708_RS17715 (3588477) | 3588477..3589028 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
P5708_RS17720 (3589144) | 3589144..3589614 | + | 471 | WP_000136192.1 | YlaC family protein | - |
P5708_RS17725 (3589778) | 3589778..3591328 | + | 1551 | WP_089638034.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
P5708_RS17730 (3591370) | 3591370..3591723 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
P5708_RS17740 (3592102) | 3592102..3592413 | + | 312 | WP_000409908.1 | MGMT family protein | - |
P5708_RS17745 (3592444) | 3592444..3593016 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T275166 WP_001291435.1 NZ_CP120563:3588086-3588304 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT275166 WP_000344800.1 NZ_CP120563:3587686-3588060 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |