Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1933202..1933970 Replicon chromosome
Accession NZ_CP120563
Organism Escherichia coli strain H22

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag P5708_RS09330 Protein ID WP_000854814.1
Coordinates 1933202..1933576 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag P5708_RS09335 Protein ID WP_071792336.1
Coordinates 1933665..1933970 (-) Length 102 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5708_RS09290 (1928598) 1928598..1929764 + 1167 WP_001297905.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
P5708_RS09295 (1929883) 1929883..1930356 + 474 WP_001105376.1 DNA gyrase inhibitor SbmC -
P5708_RS09300 (1930554) 1930554..1931612 + 1059 WP_163420058.1 FUSC family protein -
P5708_RS09305 (1931784) 1931784..1932113 + 330 WP_000450409.1 DUF496 family protein -
P5708_RS09310 (1932214) 1932214..1932348 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
P5708_RS09315 (1932450) 1932450..1932596 + 147 Protein_1825 transposase domain-containing protein -
P5708_RS09320 (1932885) 1932885..1932965 - 81 Protein_1826 hypothetical protein -
P5708_RS09325 (1933011) 1933011..1933205 - 195 WP_000988601.1 DUF5983 family protein -
P5708_RS09330 (1933202) 1933202..1933576 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
P5708_RS09335 (1933665) 1933665..1933970 - 306 WP_071792336.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
P5708_RS09340 (1934107) 1934107..1934328 - 222 WP_000692323.1 DUF987 domain-containing protein -
P5708_RS09345 (1934391) 1934391..1934867 - 477 WP_001186773.1 RadC family protein -
P5708_RS09350 (1934883) 1934883..1935356 - 474 WP_277699818.1 antirestriction protein -
P5708_RS09355 (1935619) 1935619..1936440 - 822 WP_001234710.1 DUF932 domain-containing protein -
P5708_RS09360 (1936661) 1936661..1937071 - 411 WP_000846704.1 hypothetical protein -
P5708_RS09365 (1937087) 1937087..1937764 - 678 WP_001362823.1 hypothetical protein -
P5708_RS09370 (1937899) 1937899..1938969 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(2-96)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T275159 WP_000854814.1 NZ_CP120563:c1933576-1933202 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 102 a.a.        Molecular weight: 11097.76 Da        Isoelectric Point: 5.6182

>AT275159 WP_071792336.1 NZ_CP120563:c1933970-1933665 [Escherichia coli]
MPCTVTPCFGARLVQEGNRLHYLADRAGIRGLSSDADAYPLDQAFPLLMKQLELMLTSGELNPRNQHTVTLYAKGLACEA
DTLSSCGYVYLAVYPTPEMKN

Download         Length: 306 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure

References