Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1933202..1933970 | Replicon | chromosome |
| Accession | NZ_CP120563 | ||
| Organism | Escherichia coli strain H22 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1P968 |
| Locus tag | P5708_RS09330 | Protein ID | WP_000854814.1 |
| Coordinates | 1933202..1933576 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | P5708_RS09335 | Protein ID | WP_071792336.1 |
| Coordinates | 1933665..1933970 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5708_RS09290 (1928598) | 1928598..1929764 | + | 1167 | WP_001297905.1 | serine-type D-Ala-D-Ala carboxypeptidase DacD | - |
| P5708_RS09295 (1929883) | 1929883..1930356 | + | 474 | WP_001105376.1 | DNA gyrase inhibitor SbmC | - |
| P5708_RS09300 (1930554) | 1930554..1931612 | + | 1059 | WP_163420058.1 | FUSC family protein | - |
| P5708_RS09305 (1931784) | 1931784..1932113 | + | 330 | WP_000450409.1 | DUF496 family protein | - |
| P5708_RS09310 (1932214) | 1932214..1932348 | - | 135 | WP_001297944.1 | EutP/PduV family microcompartment system protein | - |
| P5708_RS09315 (1932450) | 1932450..1932596 | + | 147 | Protein_1825 | transposase domain-containing protein | - |
| P5708_RS09320 (1932885) | 1932885..1932965 | - | 81 | Protein_1826 | hypothetical protein | - |
| P5708_RS09325 (1933011) | 1933011..1933205 | - | 195 | WP_000988601.1 | DUF5983 family protein | - |
| P5708_RS09330 (1933202) | 1933202..1933576 | - | 375 | WP_000854814.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| P5708_RS09335 (1933665) | 1933665..1933970 | - | 306 | WP_071792336.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P5708_RS09340 (1934107) | 1934107..1934328 | - | 222 | WP_000692323.1 | DUF987 domain-containing protein | - |
| P5708_RS09345 (1934391) | 1934391..1934867 | - | 477 | WP_001186773.1 | RadC family protein | - |
| P5708_RS09350 (1934883) | 1934883..1935356 | - | 474 | WP_277699818.1 | antirestriction protein | - |
| P5708_RS09355 (1935619) | 1935619..1936440 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| P5708_RS09360 (1936661) | 1936661..1937071 | - | 411 | WP_000846704.1 | hypothetical protein | - |
| P5708_RS09365 (1937087) | 1937087..1937764 | - | 678 | WP_001362823.1 | hypothetical protein | - |
| P5708_RS09370 (1937899) | 1937899..1938969 | - | 1071 | WP_000102631.1 | patatin-like phospholipase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13898.94 Da Isoelectric Point: 7.8522
>T275159 WP_000854814.1 NZ_CP120563:c1933576-1933202 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|