Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 963040..963694 | Replicon | chromosome |
Accession | NZ_CP120563 | ||
Organism | Escherichia coli strain H22 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | P5708_RS04735 | Protein ID | WP_000244781.1 |
Coordinates | 963287..963694 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | P5708_RS04730 | Protein ID | WP_000354046.1 |
Coordinates | 963040..963306 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5708_RS04710 (959118) | 959118..960551 | - | 1434 | WP_001350137.1 | 6-phospho-beta-glucosidase BglA | - |
P5708_RS04715 (960596) | 960596..960907 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
P5708_RS04720 (961071) | 961071..961730 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
P5708_RS04725 (961807) | 961807..962787 | - | 981 | WP_021513792.1 | tRNA-modifying protein YgfZ | - |
P5708_RS04730 (963040) | 963040..963306 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
P5708_RS04735 (963287) | 963287..963694 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
P5708_RS04740 (963734) | 963734..964255 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
P5708_RS04745 (964367) | 964367..965263 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
P5708_RS04750 (965288) | 965288..965998 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
P5708_RS04755 (966004) | 966004..967737 | + | 1734 | WP_042020700.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T275156 WP_000244781.1 NZ_CP120563:963287-963694 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|