Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 820991..821825 | Replicon | chromosome |
| Accession | NZ_CP120563 | ||
| Organism | Escherichia coli strain H22 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | P5708_RS03990 | Protein ID | WP_277699754.1 |
| Coordinates | 820991..821368 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | D2TSS6 |
| Locus tag | P5708_RS03995 | Protein ID | WP_012908802.1 |
| Coordinates | 821457..821825 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5708_RS03960 (816200) | 816200..817348 | - | 1149 | WP_000905922.1 | capsule polysaccharide export inner-membrane protein KpsE | - |
| P5708_RS03965 (817420) | 817420..818403 | - | 984 | WP_061157979.1 | KpsF/GutQ family sugar-phosphate isomerase | - |
| P5708_RS03970 (819214) | 819214..819384 | - | 171 | Protein_780 | IS110 family transposase | - |
| P5708_RS03975 (819726) | 819726..820561 | - | 836 | Protein_781 | DUF4942 domain-containing protein | - |
| P5708_RS03980 (820646) | 820646..820828 | - | 183 | WP_078235160.1 | DUF957 domain-containing protein | - |
| P5708_RS03985 (820834) | 820834..820994 | - | 161 | Protein_783 | DUF5983 family protein | - |
| P5708_RS03990 (820991) | 820991..821368 | - | 378 | WP_277699754.1 | TA system toxin CbtA family protein | Toxin |
| P5708_RS03995 (821457) | 821457..821825 | - | 369 | WP_012908802.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| P5708_RS04000 (821875) | 821875..822519 | - | 645 | WP_277699756.1 | antitoxin of toxin-antitoxin stability system | - |
| P5708_RS04005 (822538) | 822538..822759 | - | 222 | WP_000692300.1 | DUF987 domain-containing protein | - |
| P5708_RS04010 (822822) | 822822..823298 | - | 477 | WP_001186773.1 | RadC family protein | - |
| P5708_RS04015 (823314) | 823314..823787 | - | 474 | WP_277699818.1 | antirestriction protein | - |
| P5708_RS04020 (823881) | 823881..824126 | - | 246 | WP_001519091.1 | hypothetical protein | - |
| P5708_RS04025 (824126) | 824126..824944 | - | 819 | WP_277699821.1 | DUF932 domain-containing protein | - |
| P5708_RS04030 (825044) | 825044..825277 | - | 234 | WP_277699823.1 | DUF905 family protein | - |
| P5708_RS04035 (825356) | 825356..825811 | - | 456 | WP_042093678.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14295.45 Da Isoelectric Point: 9.4949
>T275155 WP_277699754.1 NZ_CP120563:c821368-820991 [Escherichia coli]
MKTLPDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIETGISLCDAVNFLVEKYALVRTYQPGF
SACTRSQLINSIDILRARRATGLMTRGNYKKVNNITLGKYQEAKR
MKTLPDTHVREVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIETGISLCDAVNFLVEKYALVRTYQPGF
SACTRSQLINSIDILRARRATGLMTRGNYKKVNNITLGKYQEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13829.62 Da Isoelectric Point: 6.9465
>AT275155 WP_012908802.1 NZ_CP120563:c821825-821457 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLGSCGYVYLAVYPTSETKK
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCKADTLGSCGYVYLAVYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|