Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 61104..61639 Replicon plasmid pB771_128330
Accession NZ_CP120558
Organism Escherichia coli strain B771

Toxin (Protein)


Gene name relE Uniprot ID V0VJJ7
Locus tag P5709_RS25230 Protein ID WP_000222760.1
Coordinates 61104..61391 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag P5709_RS25235 Protein ID WP_001132900.1
Coordinates 61388..61639 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P5709_RS25200 (56687) 56687..57908 - 1222 Protein_59 ISL3 family transposase -
P5709_RS25205 (58008) 58008..58372 + 365 Protein_60 IS1 family transposase -
P5709_RS25210 (58427) 58427..59209 - 783 WP_001442137.1 IS21-like element IS100kyp family helper ATPase IstB -
P5709_RS25215 (59206) 59206..60228 - 1023 WP_000255956.1 IS21-like element IS100 family transposase -
P5709_RS25220 (60317) 60317..60664 + 348 Protein_63 IS1-like element IS1A family transposase -
P5709_RS25225 (60680) 60680..61000 - 321 Protein_64 serine acetyltransferase -
P5709_RS25230 (61104) 61104..61391 - 288 WP_000222760.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
P5709_RS25235 (61388) 61388..61639 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
P5709_RS25240 (62603) 62603..63460 - 858 WP_029400224.1 incFII family plasmid replication initiator RepA -
P5709_RS25245 (63453) 63453..63527 - 75 WP_032144212.1 RepA leader peptide Tap -
P5709_RS25250 (63773) 63773..64021 - 249 WP_000083837.1 replication regulatory protein RepA -
P5709_RS25255 (64305) 64305..64454 - 150 WP_001312851.1 Hok/Gef family protein -
- (64498) 64498..64559 + 62 NuclAT_1 - -
- (64498) 64498..64559 + 62 NuclAT_1 - -
- (64498) 64498..64559 + 62 NuclAT_1 - -
- (64498) 64498..64559 + 62 NuclAT_1 - -
P5709_RS25260 (64735) 64735..65237 - 503 Protein_71 DUF2726 domain-containing protein -
P5709_RS25265 (65276) 65276..65485 - 210 WP_001299729.1 hemolysin expression modulator Hha -
P5709_RS25270 (65531) 65531..65992 - 462 WP_000978818.1 thermonuclease family protein -
P5709_RS25275 (66238) 66238..66450 - 213 WP_032303448.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - papD / papC / papH 1..128330 128330


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11105.15 Da        Isoelectric Point: 10.5832

>T275144 WP_000222760.1 NZ_CP120558:c61391-61104 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKSIQQQFAKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT275144 WP_001132900.1 NZ_CP120558:c61639-61388 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0VJJ7

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References