Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 4629075..4629912 | Replicon | chromosome |
Accession | NZ_CP120557 | ||
Organism | Escherichia coli strain B771 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | A0A140NB16 |
Locus tag | P5709_RS22520 | Protein ID | WP_000227786.1 |
Coordinates | 4629075..4629617 (-) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | P5709_RS22525 | Protein ID | WP_001297137.1 |
Coordinates | 4629601..4629912 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P5709_RS22500 (4624605) | 4624605..4625516 | - | 912 | WP_000705853.1 | 2-dehydropantoate 2-reductase | - |
P5709_RS22505 (4625684) | 4625684..4626175 | + | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
P5709_RS22510 (4626303) | 4626303..4627667 | - | 1365 | WP_001000978.1 | MFS transporter | - |
P5709_RS22515 (4628084) | 4628084..4629019 | + | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
P5709_RS22520 (4629075) | 4629075..4629617 | - | 543 | WP_000227786.1 | GNAT family N-acetyltransferase | Toxin |
P5709_RS22525 (4629601) | 4629601..4629912 | - | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
P5709_RS22530 (4630097) | 4630097..4630987 | - | 891 | WP_000971336.1 | heme o synthase | - |
P5709_RS22535 (4630999) | 4630999..4631328 | - | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
P5709_RS22540 (4631328) | 4631328..4631942 | - | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
P5709_RS22545 (4631932) | 4631932..4633923 | - | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
P5709_RS22550 (4633945) | 4633945..4634892 | - | 948 | WP_001239440.1 | cytochrome o ubiquinol oxidase subunit II | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19794.98 Da Isoelectric Point: 8.3395
>T275142 WP_000227786.1 NZ_CP120557:c4629617-4629075 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADSAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADSAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A140NB16 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0Y6B3 |